GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 08:52:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_025542753             434 bp    mRNA    linear   PLN 03-FEB-2020
DEFINITION  Aspergillus heteromorphus CBS 117.55 uncharacterized protein
            (BO70DRAFT_360327), mRNA.
ACCESSION   XM_025542753
VERSION     XM_025542753.1
DBLINK      BioProject: PRJNA479908
            BioSample: SAMN05660217
KEYWORDS    RefSeq.
SOURCE      Aspergillus heteromorphus CBS 117.55
  ORGANISM  Aspergillus heteromorphus CBS 117.55
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 434)
  AUTHORS   Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C.,
            Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Kuo,A., Riley,R., Clum,A.,
            Nolan,M., Lipzen,A., Salamov,A., Henrissat,B., Wiebenga,A., De
            vries,R.P., Grigoriev,I.V., Mortensen,U.H., Andersen,M.R. and
            Baker,S.E.
  CONSRTM   DOE Joint Genome Institute
  TITLE     The genomes of Aspergillus section Nigri reveals drivers in fungal
            speciation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 434)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 434)
  AUTHORS   Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A.,
            Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C.,
            Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Henrissat,B., Wiebenga,A., De
            vries,R.P., Mortensen,U.H., Andersen,M.R., Baker,S.E.,
            Grigoriev,I.V., Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (16-DEC-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020290411).
            
            ##Metadata-START##
            Organism Display Name :: Aspergillus heteromorphus CBS 117.55 v1.0
            GOLD Stamp ID         :: Gp0108183
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..434
                     /organism="Aspergillus heteromorphus CBS 117.55"
                     /mol_type="mRNA"
                     /strain="CBS 117.55"
                     /type_material="culture from neotype of Aspergillus
                     heteromorphus"
                     /db_xref="taxon:1448321"
                     /chromosome="Unknown"
     gene            1..434
                     /locus_tag="BO70DRAFT_360327"
                     /db_xref="GeneID:37064990"
     CDS             20..205
                     /locus_tag="BO70DRAFT_360327"
                     /note="expressed protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_025401569.1"
                     /db_xref="GeneID:37064990"
                     /db_xref="JGIDB:Asphet1_360327"
                     /translation="
MTSSRHAINPGPTNWSLQHNLLQPSADAAVGPHRHPQVTTRGQGSPAVATPTHETNGHVAV"
ORIGIN      
gatgacttgccaggtcaacatgacctcgagtcgacatgcaataaacccgggaccgaccaattggtcgctacaacataatctcctgcagcccagcgcggacgcggccgttggaccccatcggcatccacaggtcacaacccgcggacaagggtcaccagctgtcgccacaccaacgcacgagacaaacgggcatgtagcggtgtagccgatggcaccagccaccacgggaagcgtgagttggctcgcatgaaggattgggctccggagcacaaccgcgggtgtacgtagaccagacaagacaatcatattaatggctcagcagacaaccaggtccggcaagtaacctcgccacaggaaataaacacagtaagtagcaataatagcgaaaacggcaatccaaccgcgagccaagcgatcccgaggtggtattgttg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]