2025-07-04 14:42:06, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_025542753 434 bp mRNA linear PLN 21-FEB-2025 DEFINITION Aspergillus heteromorphus CBS 117.55 uncharacterized protein (BO70DRAFT_360327), mRNA. ACCESSION XM_025542753 VERSION XM_025542753.1 DBLINK BioProject: PRJNA479908 BioSample: SAMN05660217 KEYWORDS RefSeq. SOURCE Aspergillus heteromorphus CBS 117.55 ORGANISM Aspergillus heteromorphus CBS 117.55 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus subgen. Circumdati. REFERENCE 1 (bases 1 to 434) AUTHORS Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C., Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A., Henrissat,B., Wiebenga,A., De vries,R.P., Grigoriev,I.V., Mortensen,U.H., Andersen,M.R. and Baker,S.E. CONSRTM DOE Joint Genome Institute TITLE The genomes of Aspergillus section Nigri reveals drivers in fungal speciation JOURNAL Unpublished REFERENCE 2 (bases 1 to 434) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (21-FEB-2025) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 434) AUTHORS Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A., Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C., Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Henrissat,B., Wiebenga,A., De vries,R.P., Mortensen,U.H., Andersen,M.R., Baker,S.E., Grigoriev,I.V., Nordberg,H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (16-DEC-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020290411). ##Metadata-START## Organism Display Name :: Aspergillus heteromorphus CBS 117.55 v1.0 GOLD Stamp ID :: Gp0108183 ##Metadata-END## FEATURES Location/Qualifiers source 1..434 /organism="Aspergillus heteromorphus CBS 117.55" /mol_type="mRNA" /strain="CBS 117.55" /type_material="culture from neotype of Aspergillus heteromorphus" /db_xref="taxon:1448321" /chromosome="Unknown" gene 1..434 /locus_tag="BO70DRAFT_360327" /db_xref="GeneID:37064990" CDS 20..205 /locus_tag="BO70DRAFT_360327" /note="expressed protein" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_025401569.1" /db_xref="GeneID:37064990" /db_xref="JGIDB:Asphet1_360327" /translation="
MTSSRHAINPGPTNWSLQHNLLQPSADAAVGPHRHPQVTTRGQGSPAVATPTHETNGHVAV"
ORIGIN
gatgacttgccaggtcaacatgacctcgagtcgacatgcaataaacccgggaccgaccaattggtcgctacaacataatctcctgcagcccagcgcggacgcggccgttggaccccatcggcatccacaggtcacaacccgcggacaagggtcaccagctgtcgccacaccaacgcacgagacaaacgggcatgtagcggtgtagccgatggcaccagccaccacgggaagcgtgagttggctcgcatgaaggattgggctccggagcacaaccgcgggtgtacgtagaccagacaagacaatcatattaatggctcagcagacaaccaggtccggcaagtaacctcgccacaggaaataaacacagtaagtagcaataatagcgaaaacggcaatccaaccgcgagccaagcgatcccgaggtggtattgttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]