2025-07-09 14:35:58, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_025482761 300 bp mRNA linear PLN 06-JUN-2019 DEFINITION [Candida] duobushaemulonis 60S ribosomal protein L36 (CXQ87_004317), partial mRNA. ACCESSION XM_025482761 VERSION XM_025482761.1 DBLINK BioProject: PRJNA479899 BioSample: SAMN08161465 KEYWORDS RefSeq. SOURCE Candidozyma duobushaemuli (Candida duobushaemulonis) ORGANISM Candidozyma duobushaemuli Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Metschnikowiaceae; Candidozyma. REFERENCE 1 (bases 1 to 300) AUTHORS Chow,N.A., Gade,L., Batra,D., Rowe,L.A., Loparev,V.N. and Litvintseva,A.P. TITLE Genome Sequence of the Amphotericin B-resistant Candida duobushaemulonii strain, B09383 JOURNAL Unpublished REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-JUN-2019) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Chow,N.A., Gade,L., Batra,D., Rowe,L.A., Loparev,V.N. and Litvintseva,A.P. TITLE Direct Submission JOURNAL Submitted (18-DEC-2017) Mycotic Diseases Branch, Centers for Disease Control and Prevention, 1600 Clifton Road, Atlanta, GA 30329, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020289900). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="Candidozyma duobushaemuli" /mol_type="mRNA" /strain="B09383" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:1231522" /chromosome="Unknown" /geo_loc_name="USA: Tennessee" /lat_lon="36.16784 N 86.77816 W" /collection_date="2011-09" /collected_by="Tennessee Department of Health" gene <1..>300 /locus_tag="CXQ87_004317" /db_xref="GeneID:37004316" CDS 1..300 /locus_tag="CXQ87_004317" /codon_start=1 /transl_table=12 /product="60S ribosomal protein L36" /protein_id="XP_025337704.1" /db_xref="GeneID:37004316" /translation="
MARSGIAVGLNKGHKVNGKEVAPRISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRASRKVEEMSQIITESRRH"
misc_feature 7..294 /locus_tag="CXQ87_004317" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacggtaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctgagaaaggtcgaggagatgagtcagatcatcactgagtccagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]