GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-02-10 03:41:13, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_025482761             300 bp    mRNA    linear   PLN 06-JUN-2019
DEFINITION  [Candida] duobushaemulonis 60S ribosomal protein L36
            (CXQ87_004317), partial mRNA.
ACCESSION   XM_025482761
VERSION     XM_025482761.1
DBLINK      BioProject: PRJNA479899
            BioSample: SAMN08161465
KEYWORDS    RefSeq.
SOURCE      Candidozyma duobushaemuli (Candida duobushaemulonis)
  ORGANISM  Candidozyma duobushaemuli
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Metschnikowiaceae; Candidozyma.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Chow,N.A., Gade,L., Batra,D., Rowe,L.A., Loparev,V.N. and
            Litvintseva,A.P.
  TITLE     Genome Sequence of the Amphotericin B-resistant Candida
            duobushaemulonii strain, B09383
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Chow,N.A., Gade,L., Batra,D., Rowe,L.A., Loparev,V.N. and
            Litvintseva,A.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2017) Mycotic Diseases Branch, Centers for
            Disease Control and Prevention, 1600 Clifton Road, Atlanta, GA
            30329, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020289900).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Candidozyma duobushaemuli"
                     /mol_type="mRNA"
                     /strain="B09383"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:1231522"
                     /chromosome="Unknown"
                     /geo_loc_name="USA: Tennessee"
                     /lat_lon="36.16784 N 86.77816 W"
                     /collection_date="2011-09"
                     /collected_by="Tennessee Department of Health"
     gene            <1..>300
                     /locus_tag="CXQ87_004317"
                     /db_xref="GeneID:37004316"
     CDS             1..300
                     /locus_tag="CXQ87_004317"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_025337704.1"
                     /db_xref="GeneID:37004316"
                     /translation="
MARSGIAVGLNKGHKVNGKEVAPRISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRASRKVEEMSQIITESRRH"
     misc_feature    7..294
                     /locus_tag="CXQ87_004317"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacggtaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctgagaaaggtcgaggagatgagtcagatcatcactgagtccagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]