2024-05-20 10:06:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_024898053 150 bp mRNA linear PLN 27-APR-2018 DEFINITION Trichoderma citrinoviride hypothetical protein (BBK36DRAFT_38962), partial mRNA. ACCESSION XM_024898053 VERSION XM_024898053.1 DBLINK BioProject: PRJNA453598 BioSample: SAMN05369575 KEYWORDS RefSeq. SOURCE Trichoderma citrinoviride (Hypocrea schweinitzii) ORGANISM Trichoderma citrinoviride Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; Trichoderma. REFERENCE 1 (bases 1 to 150) AUTHORS Atanasova,L., Chenthamara,K., Zhang,J., Grujic,M., Henrissat,B., Kuo,A., Aerts,A., Salamov,A., Lipzen,A., Labutti,K., Barry,K., Miao,Y., Rahimi,M.J., Shen,Q., Grigoriev,I.V., Kubicek,C.P. and Druzhinina,I.S. CONSRTM DOE Joint Genome Institute TITLE Multiple horizontal gene transfer events from other fungi enriched the ability of initially mycotrophic Trichoderma (Ascomycota) to feed on dead plant biomass JOURNAL Unpublished REFERENCE 2 (bases 1 to 150) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-APR-2018) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 150) AUTHORS Kuo,A., Atanasova,L., Chenthamara,K., Zhang,J., Grujic,M., Henrissat,B., Aerts,A., Salamov,A., Lipzen,A., Labutti,K., Barry,K., Miao,Y., Rahimi,M.J., Shen,Q., Grigoriev,I.V., Kubicek,C.P., Druzhinina,I.S., Nordberg,H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (08-JUL-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020194720). ##Metadata-START## Organism Display Name :: Trichoderma citrinoviride TUCIM 6016 v4.0 GOLD Stamp ID :: Gp0009711 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..150 /organism="Trichoderma citrinoviride" /mol_type="mRNA" /strain="TUCIM 6016" /db_xref="taxon:58853" /chromosome="Unknown" gene <1..>150 /locus_tag="BBK36DRAFT_38962" /db_xref="GeneID:36606171" CDS <1..>150 /locus_tag="BBK36DRAFT_38962" /codon_start=1 /product="hypothetical protein" /protein_id="XP_024747077.1" /db_xref="GeneID:36606171" /db_xref="JGIDB:Trici4_38962" /translation="
AATAVSFFRTDYVLTSIESCGTMGNCTTTCSDKTGTLTQNSMTVILGALG"
misc_feature <52..>150 /locus_tag="BBK36DRAFT_38962" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
gcagccacagccgtctcttttttccgcacggactacgtacttacaagcatcgaatcatgcgggacaatggggaactgcacaactacctgttcggacaaaacaggcaccctgactcaaaactcgatgactgtgattttaggcgcactagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]