GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-22 06:10:25, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_024857773             300 bp    mRNA    linear   PLN 26-APR-2018
DEFINITION  [Candida] pseudohaemulonii 60S ribosomal protein L36
            (C7M61_002398), partial mRNA.
ACCESSION   XM_024857773
VERSION     XM_024857773.1
DBLINK      BioProject: PRJNA453594
            BioSample: SAMN08714088
KEYWORDS    RefSeq.
SOURCE      [Candida] pseudohaemulonis
  ORGANISM  [Candida] pseudohaemulonis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora;
            Clavispora/Candida clade.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N.
            and Cuomo,C.A.
  TITLE     Candida pseudohaemulonii genome assembly and annotation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N.
            and Cuomo,C.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2018) Genome Sequencing and Analysis Program,
            Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA
            02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020194438).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="[Candida] pseudohaemulonis"
                     /mol_type="mRNA"
                     /strain="B12108"
                     /host="Homo sapiens"
                     /db_xref="taxon:418784"
                     /chromosome="Unknown"
                     /country="Venezuela"
                     /collected_by="CDC"
     gene            <1..>300
                     /locus_tag="C7M61_002398"
                     /db_xref="GeneID:36565787"
     CDS             1..300
                     /locus_tag="C7M61_002398"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_024714272.1"
                     /db_xref="GeneID:36565787"
                     /translation="
MARSGIAVGLNKGHKVNAKEVAPRISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIITESRRH"
     misc_feature    7..294
                     /locus_tag="C7M61_002398"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:307352"
ORIGIN      
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggtcgaggagatgaaccagatcatcactgagtccagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]