LOCUS       XM_024807624             207 bp    mRNA    linear   PLN 26-APR-2018
DEFINITION  [Candida] sorbophila hypothetical protein (B9G98_01066), partial
            mRNA.
ACCESSION   XM_024807624
VERSION     XM_024807624.1
DBLINK      BioProject: PRJNA453587
            BioSample: SAMN06765614
KEYWORDS    RefSeq.
SOURCE      Wickerhamiella sorbophila
  ORGANISM  Wickerhamiella sorbophila
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Wickerhamiella.
REFERENCE   1  (bases 1 to 207)
  AUTHORS   Ahn,J.O.
  TITLE     Genome sequencing of [Candida] sorbophila
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 207)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 207)
  AUTHORS   Ahn,J.O.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-APR-2017) Biotechnology Process Engineering Center,
            KRIBB, 30 Yeongudanji-ro, Ochang-eup Cheongwon-gu, Cheong-joo
            363-883, South Korea
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020193984).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..207
                     /organism="Wickerhamiella sorbophila"
                     /mol_type="mRNA"
                     /strain="DS02"
                     /isolation_source="Industrial water"
                     /db_xref="taxon:45607"
                     /chromosome="Unknown"
                     /country="South Korea"
                     /collection_date="Jan-2015"
     gene            <1..>207
                     /locus_tag="B9G98_01066"
                     /db_xref="GeneID:36514815"
     CDS             1..207
                     /locus_tag="B9G98_01066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024663392.1"
                     /db_xref="GeneID:36514815"
                     /db_xref="GO:0005783"
                     /db_xref="InterPro:IPR010580"
                     /db_xref="PFAM:PF06624"
                     /translation="

MAPQTPAQRAANEKYARRELAKKGKRVAPTYKSKLDKKPARKIPFGYIAFFLFLILGTVFVEAIIGRA"

ORIGIN      

atggctcctcaaacaccagctcagagagcggctaacgaaaagtacgcacgccgggaattggctaagaaaggaaagcgcgtagcaccaacatacaagtccaagttggataaaaagccagcacgcaagatcccctttgggtacatcgctttcttcttatttttgattcttggtactgtgtttgttgaagctattattggtcgagcatga

//