LOCUS       XM_024492116             285 bp    mRNA    linear   INV 04-APR-2018
DEFINITION  Echinococcus granulosus hypothetical protein (EGR_02867), partial
            mRNA.
ACCESSION   XM_024492116
VERSION     XM_024492116.1
DBLINK      BioProject: PRJNA182977
            BioSample: SAMN01914755
KEYWORDS    RefSeq.
SOURCE      Echinococcus granulosus
  ORGANISM  Echinococcus granulosus
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes;
            Cestoda; Eucestoda; Cyclophyllidea; Taeniidae; Echinococcus;
            Echinococcus granulosus group.
REFERENCE   1  (bases 1 to 285)
  AUTHORS   Zheng,H., Zhang,W., Zhang,L., Zhang,Z., Li,J., Lu,G., Zhu,Y.,
            Wang,Y., Huang,Y., Liu,J., Kang,H., Chen,J., Wang,L., Chen,A.,
            Yu,S., Gao,Z., Jin,L., Gu,W., Wang,Z., Zhao,L., Shi,B., Wen,H.,
            Lin,R., Jones,M.K., Brejova,B., Vinar,T., Zhao,G., McManus,D.P.,
            Chen,Z., Zhou,Y. and Wang,S.
  TITLE     The genome of the hydatid tapeworm Echinococcus granulosus
  JOURNAL   Nat. Genet. 45 (10), 1168-1175 (2013)
   PUBMED   24013640
REFERENCE   2  (bases 1 to 285)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 285)
  AUTHORS   Zheng,H., Zhang,W., Zhang,L., Zhu,Y., Huang,Y., McManus,D.P.,
            Chen,Z., Zhou,Y. and Wang,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-FEB-2013) Shanghai-MOST Key Laboratory of Health and
            Disease Genomics, Chinese National Human Genome Center at Shanghai,
            No. 250 Bibo Road, Shanghai 201203, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020170393).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..285
                     /organism="Echinococcus granulosus"
                     /mol_type="mRNA"
                     /db_xref="taxon:6210"
                     /chromosome="Unknown"
     gene            <1..>285
                     /locus_tag="EGR_02867"
                     /db_xref="GeneID:36338582"
     CDS             1..285
                     /locus_tag="EGR_02867"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024353610.1"
                     /db_xref="GeneID:36338582"
                     /translation="

MSIYVEQMRSKYTYLRIRMQRSNSVCRSTTSKTKWYLSFCHWMAVVYGRVSRRDWLDSKHQINQELEDALASLAKPQSPSGQMRAISLKNLPSL"

ORIGIN      

atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga

//