ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-08 09:45:43, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_024492116 285 bp mRNA linear INV 04-APR-2018
DEFINITION Echinococcus granulosus hypothetical protein (EGR_02867), partial
mRNA.
ACCESSION XM_024492116
VERSION XM_024492116.1
DBLINK BioProject: PRJNA182977
BioSample: SAMN01914755
KEYWORDS RefSeq.
SOURCE Echinococcus granulosus
ORGANISM Echinococcus granulosus
Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes;
Cestoda; Eucestoda; Cyclophyllidea; Taeniidae; Echinococcus;
Echinococcus granulosus group.
REFERENCE 1 (bases 1 to 285)
AUTHORS Zheng,H., Zhang,W., Zhang,L., Zhang,Z., Li,J., Lu,G., Zhu,Y.,
Wang,Y., Huang,Y., Liu,J., Kang,H., Chen,J., Wang,L., Chen,A.,
Yu,S., Gao,Z., Jin,L., Gu,W., Wang,Z., Zhao,L., Shi,B., Wen,H.,
Lin,R., Jones,M.K., Brejova,B., Vinar,T., Zhao,G., McManus,D.P.,
Chen,Z., Zhou,Y. and Wang,S.
TITLE The genome of the hydatid tapeworm Echinococcus granulosus
JOURNAL Nat. Genet. 45 (10), 1168-1175 (2013)
PUBMED 24013640
REFERENCE 2 (bases 1 to 285)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (03-APR-2018) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 285)
AUTHORS Zheng,H., Zhang,W., Zhang,L., Zhu,Y., Huang,Y., McManus,D.P.,
Chen,Z., Zhou,Y. and Wang,S.
TITLE Direct Submission
JOURNAL Submitted (27-FEB-2013) Shanghai-MOST Key Laboratory of Health and
Disease Genomics, Chinese National Human Genome Center at Shanghai,
No. 250 Bibo Road, Shanghai 201203, China
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_020170393).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..285
/organism="Echinococcus granulosus"
/mol_type="mRNA"
/db_xref="taxon:6210"
/chromosome="Unknown"
gene <1..>285
/locus_tag="EGR_02867"
/db_xref="GeneID:36338582"
CDS 1..285
/locus_tag="EGR_02867"
/codon_start=1
/product="hypothetical protein"
/protein_id="XP_024353610.1"
/db_xref="GeneID:36338582"
/translation="
MSIYVEQMRSKYTYLRIRMQRSNSVCRSTTSKTKWYLSFCHWMAVVYGRVSRRDWLDSKHQINQELEDALASLAKPQSPSGQMRAISLKNLPSL"
ORIGIN
atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]