2024-03-28 20:30:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_024166711 456 bp mRNA linear PLN 26-FEB-2018 DEFINITION PREDICTED: Morus notabilis uncharacterized LOC21408890 (LOC21408890), mRNA. ACCESSION XM_024166711 VERSION XM_024166711.1 DBLINK BioProject: PRJNA263939 KEYWORDS RefSeq; includes ab initio. SOURCE Morus notabilis ORGANISM Morus notabilis Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Moreae; Morus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_010361515.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Morus notabilis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..456 /organism="Morus notabilis" /mol_type="mRNA" /db_xref="taxon:981085" /chromosome="Unknown" /country="China" /authority="Morus notabilis C.K.Schneid." gene 1..456 /gene="LOC21408890" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:21408890" CDS 1..456 /gene="LOC21408890" /codon_start=1 /product="uncharacterized protein LOC21408890" /protein_id="XP_024022479.1" /db_xref="GeneID:21408890" /translation="
MKDNKLQESQKWLEDHSKGVIGSELVTSTLEGLQVVASHEGFFRCHFLVPSSLLDQRGNWHIGAIATLIDSVGAATAHSLFGPIRASVDFIISYFSTAKFQEEIEIEAKAVRGQGKLVGFMVEVKRKGSGELIAIGKQWMASKGQEKSSRL"
misc_feature 94..423 /gene="LOC21408890" /note="PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not...; Region: PaaI_thioesterase; cd03443" /db_xref="CDD:239527" misc_feature order(178..180,259..261,280..291) /gene="LOC21408890" /note="CoenzymeA binding site [chemical binding]; other site" /db_xref="CDD:239527" misc_feature order(181..183,187..189,196..198,262..276,280..282) /gene="LOC21408890" /note="subunit interaction site [polypeptide binding]; other site" /db_xref="CDD:239527" misc_feature order(184..186,208..213,220..225,259..261) /gene="LOC21408890" /note="PHB binding site [active]" /db_xref="CDD:239527" ORIGIN
atgaaagacaacaaacttcaggagtctcaaaaatggcttgaagatcattcaaagggcgtcataggaagtgaattggtgacttcaactttggagggccttcaggtggttgcatcccatgaaggctttttccgctgtcacttccttgtaccgagtagccttttggatcaacgtggaaactggcacatcggagcgatagccacgttgatcgatagcgtaggcgccgccacggcacactcgttgtttggtcccatcagagcatccgttgactttatcatctcatacttctcaacggctaagtttcaagaagagattgagatagaggccaaggctgtaagaggacaaggaaagcttgtagggtttatggtggaagtgaaaagaaaaggtagtggagaattgattgccattggtaagcaatggatggcctcaaaaggtcaagagaaaagtagtaggctttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]