LOCUS       XM_024044169             942 bp    mRNA    linear   PLN 15-FEB-2018
DEFINITION  PREDICTED: Quercus suber laccase-14-like (LOC112011830), mRNA.
ACCESSION   XM_024044169
VERSION     XM_024044169.1
DBLINK      BioProject: PRJNA433227
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Quercus suber
  ORGANISM  Quercus suber
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fagales; Fagaceae; Quercus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019826308.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Quercus suber Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 44% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..942
                     /organism="Quercus suber"
                     /mol_type="mRNA"
                     /isolate="HL8"
                     /db_xref="taxon:58331"
                     /chromosome="Unknown"
                     /tissue_type="leaves"
                     /country="Portugal:Montargil"
     gene            1..942
                     /gene="LOC112011830"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 55% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:112011830"
     CDS             1..942
                     /gene="LOC112011830"
                     /codon_start=1
                     /product="laccase-14-like"
                     /protein_id="XP_023899937.1"
                     /db_xref="GeneID:112011830"
                     /translation="

MASYMPTNISGIYTADFPDNPPSFFNFTEDDSPDDTTLSVQGTKVRMLNYNEEVEIVFQGTNLLDVSMDHPMHLHGYSFYVIGSGYGVFDIETDPKGYNFDDPPKLNTVTLPKNGWVAIRFKASNPGMNISGIYTADFPDNPPSFFNFTEDDSPDDTTLSVQGTKVRMLNYNEEVEIVFQGTNLLDVSMDHPMHLHGYSFYVIGSGYGVFDIETDPKGYNFDDPPKLNTVTLPKNGWVAIRFKASNPGVWLWHCHYERHLSWGMSSVFIVKNGGTSETSIREPPPYLPPCKDSFTSRLLQYENSDGNRLNKID"

     misc_feature    46..384
                     /gene="LOC112011830"
                     /note="Multicopper oxidase; Region: Cu-oxidase_2;
                     pfam07731"
                     /db_xref="CDD:400194"
     misc_feature    397..819
                     /gene="LOC112011830"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:450256"
ORIGIN      

atggcatcatacatgccaacgaacataagtgggatttacaccgcagattttccagacaatccaccttcatttttcaacttcactgaagatgattctccggatgacacaactctgtctgtccaggggaccaaggtaaggatgctgaattataatgaagaggtggagatagtgtttcagggtactaatttgctagatgtatcgatggatcacccaatgcaccttcatgggtactccttctatgtgattggctcaggttatggggtctttgatattgagactgacccaaaaggctacaattttgatgatccacctaagttgaacactgttacactccctaagaatggatgggttgccataagattcaaagcaagtaatcctggtatgaacataagtgggatttacaccgcagattttccagacaatccaccttcatttttcaacttcactgaagatgattctccggatgacacaactctgtctgtccaggggaccaaggtaaggatgctgaattataatgaagaggtggagatagtgtttcagggtactaatttgctagatgtatcgatggatcacccaatgcaccttcatgggtactccttctatgtgattggctcaggttatggggtctttgatattgagactgacccaaaaggctacaattttgatgatccacctaagttgaacactgttacactccctaagaatggatgggttgccataagattcaaagcaagtaatcctggagtatggttatggcattgtcattatgaacgacatttaagttggggtatgagcagtgtctttatagtgaaaaatggtgggacatcggagacgagtatacgcgaacccccaccttacttgcctccttgtaaggattcatttaccagtaggctcctacaatacgagaactcagatgggaatagattgaataagattgattag

//