2024-05-20 06:52:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023884671 1398 bp mRNA linear PLN 22-DEC-2022 DEFINITION PREDICTED: Lactuca sativa uncharacterized LOC111888508 (LOC111888508), mRNA. ACCESSION XM_023884671 VERSION XM_023884671.2 DBLINK BioProject: PRJNA432228 KEYWORDS RefSeq; includes ab initio. SOURCE Lactuca sativa (garden lettuce) ORGANISM Lactuca sativa Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_056627) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 22, 2022 this sequence version replaced XM_023884671.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_002870075.4-RS_2022_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1398 /organism="Lactuca sativa" /mol_type="mRNA" /cultivar="Salinas" /db_xref="taxon:4236" /chromosome="5" gene 1..1398 /gene="LOC111888508" /note="uncharacterized LOC111888508; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:111888508" CDS 1..1398 /gene="LOC111888508" /codon_start=1 /product="uncharacterized protein LOC111888508" /protein_id="XP_023740439.2" /db_xref="GeneID:111888508" /translation="
MALRHLIIMLPLLFASCSGGADARKGYLCPGGGNGGKGCPCPGGCPCPAAADGGKECPCPGGGDGGKGCHCPDGCPCPGAADSEKGCPCSGGADGGKGCHCPDGCSCPAAVDGGKECRCPGGGDGGKGCHCPDGCSCPAATDGGKECICPGGGDGGKGCHCPDGCPCPAATDSGKECPCPGGADGGKGCHCPDGCSCPAATDGGKECICPGGGDGGKGCHCPDGCSCPAATDGGKECPCSGGADGGKGCPCAGGADGGIGCPCAGGADGGKGCPCAGDAGGGKGCPCAGGADGGKGCPCAGDAAGGKGCPCAGGADNVKGCPCAGGPDGAKGCPCAGGADGGKGCPCAGGADGGKGCPCAGGAEGGKGCPCAGGAEGRKGCPCAGGADGGKGCPCAGGVCCGKGCPCAGGAEGGKGCPCADGSEGGKGCPCAGGADNGKGCPCAGGADGGKDSKQDVTEKGNIKT"
ORIGIN
atggcactcagacacctaatcatcatgctccctttgttatttgcatcttgttcgggtggtgccgatgccaggaaaggttacctttgtccgggtggtggcaacggtgggaaagggtgcccttgtccgggtgggtgtccttgtccagctgctgccgatggtgggaaagaatgcccttgtccgggtggtggtgacggcgggaaagggtgccattgtccggatgggtgtccttgtccgggtgctgccgacagtgagaaaggctgcccttgttcgggtggtgctgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctgtcgacggtggtaaagaatgtcgttgtccgggtggtggcgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctaccgatggagggaaagaatgcatttgtccgggtggtggtgacggagggaaagggtgccattgtccagatgggtgtccttgtccggctgctacagacagtggtaaagagtgcccttgtccgggtggtgccgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctaccgatggtgggaaagaatgcatttgtccgggtggtggtgacggagggaaagggtgccattgtccggatgggtgttcttgtccggctgctacagacggtggtaaagagtgcccttgttcgggtggtgccgacggtgggaaaggttgcccttgtgcgggtggtgccgacggggggatagggtgcccttgtgcgggaggtgccgacggcgggaaaggatgcccttgtgcgggtgatgccggcggtggaaaagggtgcccttgtgcgggtggtgccgacggagggaaagggtgcccttgtgcgggtgatgccgctggcgggaaagggtgcccttgtgcgggtggtgccgacaacgtgaaagggtgcccttgtgcgggaggtcccgacggtgcgaaagggtgtccttgtgcgggtggtgccgacggcggaaaaggatgcccttgtgcgggtggtgccgacggcgggaaaggatgcccttgtgcgggtggtgctgaaggcgggaaaggctgcccttgtgctggtggtgctgaaggcaggaaaggttgcccttgtgcgggtggtgccgatggcgggaaaggttgcccttgtgcgggtggtgtctgttgcgggaaaggttgcccttgtgcgggtggtgccgaaggagggaaaggatgcccttgtgcggatggttccgaaggcgggaaaggttgcccttgtgcaggtggtgccgacaacgggaaaggctgcccttgtgcgggtggtgccgacggcgggaaagacagcaaacaggatgttacagaaaaagggaacatcaaaacttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]