2024-05-19 13:24:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023765091 976 bp mRNA linear MAM 26-JAN-2018 DEFINITION PREDICTED: Myotis lucifugus copper chaperone for superoxide dismutase (CCS), transcript variant X2, mRNA. ACCESSION XM_023765091 VERSION XM_023765091.1 DBLINK BioProject: PRJNA208947 KEYWORDS RefSeq. SOURCE Myotis lucifugus (little brown bat) ORGANISM Myotis lucifugus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Vespertilionidae; Myotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_005871421.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Myotis lucifugus Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..976 /organism="Myotis lucifugus" /mol_type="mRNA" /db_xref="taxon:59463" /chromosome="Unknown" /sex="female" /country="USA: Framingham, MA" gene 1..976 /gene="CCS" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:102440019" CDS 114..809 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_023620859.1" /db_xref="GeneID:102440019" /translation="
MASDSGDRETACTLEFAVQMTCQSCVDAVRRSLQGVAENLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTRNCNSCGDHFNPDGTSHGGPRDSDRHRGDLGNVHADANGQAIFRIEDEQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICTCDGLTIWEERGRPIAGKGRKEPSQPSQPPAHL"
misc_feature 156..>221 /gene="CCS" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(171..179,186..188) /gene="CCS" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 240..656 /gene="CCS" /note="Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the...; Region: Cu-Zn_Superoxide_Dismutase; cd00305" /db_xref="CDD:238186" misc_feature order(243..245,249..251,279..281,285..287,375..383, 555..560) /gene="CCS" /note="E-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature order(315..317,489..491) /gene="CCS" /note="P-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature order(363..365,369..371,414..416,465..467,474..476, 576..578) /gene="CCS" /note="active site" /db_xref="CDD:238186" misc_feature order(363..365,369..371,414..416,576..578) /gene="CCS" /note="Cu2+ binding site [ion binding]; other site" /db_xref="CDD:238186" misc_feature order(414..416,438..440,465..467,474..476) /gene="CCS" /note="Zn2+ binding site [ion binding]; other site" /db_xref="CDD:238186" ORIGIN
caggaggcgggacaaagcctggcttccgaggctccgcctcctcgtgatgctgcttggatttccgctgtaggactcgagctgttctggtcctcctgccagtgactgggtccgagatggcgtcggactcgggggaccgggagaccgcctgcacgttggagttcgccgtgcagatgacctgtcagagctgtgtggacgcagtgcgcaggtccctgcaaggggtggcagagaatctgggggcagcagtggccattctaggaggccctggccctgtgcagggggtggtgcgcttcctacagctgacccctgagcgctgcctcattgagggaaccattgatggcctggagcctgggccacacggactccatgtccatcagttcggggacctcacaaggaactgcaacagctgtggggaccactttaaccctgatggaacatctcatgggggccctcgggactctgaccggcaccggggagacctggggaacgtccacgctgatgctaatggccaagccatcttcaggatagaggatgagcagctgaaggtatgggatgtgattggccgaagcctggtcattgatgagggagaagacgacctgggccggggcggccatcccttatccaagatcacggggaactcaggagagaggttggcctgtggcatcattgcacgctccgctggccttttccagaaccccaagcagatctgcacctgcgacggcctcaccatctgggaggagcgaggccggcccattgctggcaagggacgaaaggaaccgtcgcagccatcccagccccctgcccacctctgagcaaggcctccgcctcagtctcaggtccaccatcctcccagctgatgccatcctcttccaggggatgggggagccctgcttgcctagtccgagaacaagggtacggggtgtgcagggattgctgtgacgctcccttggcaaagtaaagtttttctattcatatggaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]