2025-07-13 15:36:17, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_023483453 433 bp mRNA linear INV 16-OCT-2023 DEFINITION PREDICTED: Eurytemora carolleeae BBSome-interacting protein 1-like (LOC111709665), mRNA. ACCESSION XM_023483453 VERSION XM_023483453.1 DBLINK BioProject: PRJNA423276 KEYWORDS RefSeq. SOURCE Eurytemora carolleeae ORGANISM Eurytemora carolleeae Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Hexanauplia; Copepoda; Calanoida; Temoridae; Eurytemora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019396880.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000591075.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/05/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..433 /organism="Eurytemora carolleeae" /mol_type="mRNA" /db_xref="taxon:1294199" /chromosome="Unknown" gene 1..433 /gene="LOC111709665" /note="BBSome-interacting protein 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 49 samples with support for all annotated introns" /db_xref="GeneID:111709665" CDS 48..326 /gene="LOC111709665" /codon_start=1 /product="BBSome-interacting protein 1-like" /protein_id="XP_023339221.1" /db_xref="GeneID:111709665" /translation="
MSEDKNRFPELVNPVLPKRGLVYQESNPQLVLCKPKLLPLKSMTLEKMERMQKEANEKAKEMQEEIEKEKQAGFTDTIGSEETADVLTLDDD"
misc_feature 48..242 /gene="LOC111709665" /note="Cilia BBSome complex subunit 10; Region: BBIP10; pfam14777" /db_xref="CDD:464310" ORIGIN
attgtgacacctatatattttaagaaatatgtattaaaatctatagaatgagtgaagacaagaatagatttcctgaactagtaaaccctgttctaccaaaacgtggattagtttatcaagaaagtaatcctcaactagttctctgcaagccaaagcttctgcccctgaagtctatgaccctggagaagatggaaaggatgcagaaggaggcgaacgagaaggcgaaggaaatgcaagaagagattgagaaagagaaacaggctgggttcactgataccatagggtccgaagagaccgcagatgttttaacattagatgacgattagatgatacttcagaaaacactagaatctcaaaatcaattaattgcagttttttccagaaaagtgaactgaaaactttgttaattgtgttaatgggaaattctaacaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]