GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-13 15:36:17, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_023483453             433 bp    mRNA    linear   INV 16-OCT-2023
DEFINITION  PREDICTED: Eurytemora carolleeae BBSome-interacting protein 1-like
            (LOC111709665), mRNA.
ACCESSION   XM_023483453
VERSION     XM_023483453.1
DBLINK      BioProject: PRJNA423276
KEYWORDS    RefSeq.
SOURCE      Eurytemora carolleeae
  ORGANISM  Eurytemora carolleeae
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Hexanauplia; Copepoda; Calanoida; Temoridae;
            Eurytemora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019396880.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000591075.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/05/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..433
                     /organism="Eurytemora carolleeae"
                     /mol_type="mRNA"
                     /db_xref="taxon:1294199"
                     /chromosome="Unknown"
     gene            1..433
                     /gene="LOC111709665"
                     /note="BBSome-interacting protein 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 49 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:111709665"
     CDS             48..326
                     /gene="LOC111709665"
                     /codon_start=1
                     /product="BBSome-interacting protein 1-like"
                     /protein_id="XP_023339221.1"
                     /db_xref="GeneID:111709665"
                     /translation="
MSEDKNRFPELVNPVLPKRGLVYQESNPQLVLCKPKLLPLKSMTLEKMERMQKEANEKAKEMQEEIEKEKQAGFTDTIGSEETADVLTLDDD"
     misc_feature    48..242
                     /gene="LOC111709665"
                     /note="Cilia BBSome complex subunit 10; Region: BBIP10;
                     pfam14777"
                     /db_xref="CDD:464310"
ORIGIN      
attgtgacacctatatattttaagaaatatgtattaaaatctatagaatgagtgaagacaagaatagatttcctgaactagtaaaccctgttctaccaaaacgtggattagtttatcaagaaagtaatcctcaactagttctctgcaagccaaagcttctgcccctgaagtctatgaccctggagaagatggaaaggatgcagaaggaggcgaacgagaaggcgaaggaaatgcaagaagagattgagaaagagaaacaggctgggttcactgataccatagggtccgaagagaccgcagatgttttaacattagatgacgattagatgatacttcagaaaacactagaatctcaaaatcaattaattgcagttttttccagaaaagtgaactgaaaactttgttaattgtgttaatgggaaattctaacaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]