GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:37:19, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_023483453             433 bp    mRNA    linear   INV 10-JAN-2018
DEFINITION  PREDICTED: Eurytemora affinis BBSome-interacting protein 1-like
            (LOC111709665), mRNA.
ACCESSION   XM_023483453
VERSION     XM_023483453.1
DBLINK      BioProject: PRJNA423276
KEYWORDS    RefSeq.
SOURCE      Eurytemora affinis
  ORGANISM  Eurytemora affinis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Maxillopoda;
            Copepoda; Calanoida; Temoridae; Eurytemora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019396880.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Eurytemora affinis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..433
                     /organism="Eurytemora affinis"
                     /mol_type="mRNA"
                     /strain="Atlantic clade"
                     /isolation_source="salt marsh"
                     /db_xref="taxon:88015"
                     /chromosome="Unknown"
                     /dev_stage="egg"
                     /country="Canada: Baie de L'Isle Verte, St. Lawrence
                     estuary (salt marsh), Quebec"
                     /collection_date="2006/2007"
     gene            1..433
                     /gene="LOC111709665"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 49 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111709665"
     CDS             48..326
                     /gene="LOC111709665"
                     /codon_start=1
                     /product="BBSome-interacting protein 1-like"
                     /protein_id="XP_023339221.1"
                     /db_xref="GeneID:111709665"
                     /translation="
MSEDKNRFPELVNPVLPKRGLVYQESNPQLVLCKPKLLPLKSMTLEKMERMQKEANEKAKEMQEEIEKEKQAGFTDTIGSEETADVLTLDDD"
     misc_feature    90..242
                     /gene="LOC111709665"
                     /note="Cilia BBSome complex subunit 10; Region: BBIP10;
                     pfam14777"
                     /db_xref="CDD:317216"
ORIGIN      
attgtgacacctatatattttaagaaatatgtattaaaatctatagaatgagtgaagacaagaatagatttcctgaactagtaaaccctgttctaccaaaacgtggattagtttatcaagaaagtaatcctcaactagttctctgcaagccaaagcttctgcccctgaagtctatgaccctggagaagatggaaaggatgcagaaggaggcgaacgagaaggcgaaggaaatgcaagaagagattgagaaagagaaacaggctgggttcactgataccatagggtccgaagagaccgcagatgttttaacattagatgacgattagatgatacttcagaaaacactagaatctcaaaatcaattaattgcagttttttccagaaaagtgaactgaaaactttgttaattgtgttaatgggaaattctaacaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]