LOCUS       XM_023473533             423 bp    mRNA    linear   INV 16-OCT-2023
DEFINITION  PREDICTED: Eurytemora carolleeae major royal jelly protein 5-like
            (LOC111702015), mRNA.
ACCESSION   XM_023473533
VERSION     XM_023473533.1
DBLINK      BioProject: PRJNA423276
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Eurytemora carolleeae
  ORGANISM  Eurytemora carolleeae
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Hexanauplia; Copepoda; Calanoida; Temoridae;
            Eurytemora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019396376.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000591075.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/05/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Eurytemora carolleeae"
                     /mol_type="mRNA"
                     /db_xref="taxon:1294199"
                     /chromosome="Unknown"
     gene            1..423
                     /gene="LOC111702015"
                     /note="major royal jelly protein 5-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:111702015"
     CDS             1..423
                     /gene="LOC111702015"
                     /codon_start=1
                     /product="major royal jelly protein 5-like"
                     /protein_id="XP_023329301.1"
                     /db_xref="GeneID:111702015"
                     /translation="

MDELDELDELKKLDELDEVDEVNEVDELDELDEKYEVDELNELDDLDELDELDEVDKLDELDELDELDELDEMDEVDELDELDELDELDELDELDEDELNDLYELDELDELDELYELDELDELDELETKNKCTGPWFMSL"

ORIGIN      

atggatgagctggatgaactggatgagctgaaaaagctggatgagctggatgaggtggatgaggtgaatgaggtggatgagctggatgagctggatgagaaatatgaggtggatgagctgaatgagctggatgacctggatgagttggatgagctggatgaggtggataagctggatgagctggatgagctggatgagctggatgagctggatgagatggatgaggtggatgagctggatgagctggatgagctggatgagctggatgagctggatgaattggatgaggatgagctgaatgacctgtatgagctggatgagctggatgagctggatgaactgtatgagttggatgaactggatgagctggatgagctggagaccaagaataaatgtactggcccctggtttatgagcctgtaa

//