LOCUS       XM_023454589             597 bp    mRNA    linear   INV 10-JAN-2018
DEFINITION  PREDICTED: Anoplophora glabripennis coiled-coil domain-containing
            protein 1-like (LOC108908113), mRNA.
ACCESSION   XM_023454589
VERSION     XM_023454589.1
DBLINK      BioProject: PRJNA348318
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Anoplophora glabripennis (Asian longhorned beetle)
  ORGANISM  Anoplophora glabripennis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Coleoptera; Polyphaga;
            Cucujiformia; Chrysomeloidea; Cerambycidae; Lamiinae; Lamiini;
            Anoplophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019416451.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Anoplophora glabripennis Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..597
                     /organism="Anoplophora glabripennis"
                     /mol_type="mRNA"
                     /isolate="ALB-LARVAE"
                     /isolation_source="'mixed' research colony (originating
                     from wild-collected US specimens from several localities)"
                     /db_xref="taxon:217634"
                     /chromosome="Unknown"
                     /country="USA: Otis Air National Guard Base, MA"
                     /collection_date="Aug-2011"
     gene            1..597
                     /gene="LOC108908113"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108908113"
     CDS             1..597
                     /gene="LOC108908113"
                     /codon_start=1
                     /product="coiled-coil domain-containing protein 1-like"
                     /protein_id="XP_023310357.1"
                     /db_xref="GeneID:108908113"
                     /translation="

MFHKIDPHLNGDNNVDGGDVHNVNNDDGDVHDGDIDVAVVDDGNVDNGDVNDGQVDDGDVDYDAGDVDDGYVDHGDVDVDDVDDVAVDGGDVDNGDVDDGDVDYGDVDYGGINDGGVDVDDVDDSDIDVDEGHVDDGDVDDSNLDDGDVDDVTCDDGDVDDSDVDNSDVDYGDVDDDDVNDGNVNDGAVEDDTAIMVM"

ORIGIN      

atgtttcacaaaatcgacccacatttgaatggtgataataatgtagatggtggtgatgtacataatgtaaataatgatgatggtgatgtacatgatggtgatatagatgttgctgtagtagatgatggtaatgtagataatggcgatgtaaatgatggtcaggtagatgacggtgatgtagattatgatgctggcgatgtagatgatggttatgtagaccatggcgatgtagatgtagatgatgtagatgatgttgctgtagatggtggcgatgtagataatggcgatgtagatgatggtgatgtagattatggtgatgtagattatggtggtataaatgatggtggtgtagatgtagatgatgtagatgatagcgatatagatgtagatgagggtcatgtagatgatggcgatgtggatgatagtaatttagatgatggtgatgtagatgatgtgacatgtgatgatggagatgtagatgatagtgatgtagataatagcgatgtagattatggtgatgttgatgatgacgatgtaaatgatggtaatgtaaatgacggtgctgtagaagatgatactgcaattatggtgatgtag

//