2024-05-20 09:43:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023419193 340 bp mRNA linear VRT 26-DEC-2017 DEFINITION PREDICTED: Seriola lalandi dorsalis sodium/potassium-transporting ATPase subunit alpha-2-like (LOC111664544), partial mRNA. ACCESSION XM_023419193 VERSION XM_023419193.1 DBLINK BioProject: PRJNA423295 KEYWORDS RefSeq. SOURCE Seriola lalandi dorsalis ORGANISM Seriola lalandi dorsalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Carangiformes; Carangidae; Seriola. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019472252.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Seriola lalandi dorsalis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..340 /organism="Seriola lalandi dorsalis" /mol_type="mRNA" /isolate="HSWRI2012SDOR001" /sub_species="dorsalis" /db_xref="taxon:1841481" /chromosome="Unknown" /tissue_type="heart" /dev_stage="adult" /ecotype="SW California" gene <1..>340 /gene="LOC111664544" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns" /db_xref="GeneID:111664544" CDS <1..>340 /gene="LOC111664544" /codon_start=1 /product="sodium/potassium-transporting ATPase subunit alpha-2-like" /protein_id="XP_023274961.1" /db_xref="GeneID:111664544" /translation="
FHLTFSHLSQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCID"
misc_feature <25..>340 /gene="LOC111664544" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" misc_feature order(52..57,67..69) /gene="LOC111664544" /note="HAD signature motif IV; other site" /db_xref="CDD:319763" ORIGIN
tttcaccttaccttttctcatctctcccagggtgccattgtggctgtgacaggtgatggtgtgaatgactctcctgcactgaaaaaggccgacattggtgttgccatgggaatctcaggctctgatgtgtccaaacaggctgcagacatgatcttgttggatgacaactttgcatctattgtcacaggagtggaagaaggccgcctgatctttgataaccttaaaaagtccatcgcctacacactgaccagcaacatcccagaaatcacacccttcctgctgttcatcattgtcaatattcccctgccactgggaaccatcaccatcctgtgtattgacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]