2024-05-20 09:04:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023042150 360 bp mRNA linear PLN 19-NOV-2017 DEFINITION PREDICTED: Olea europaea var. sylvestris calcium-transporting ATPase 5, plasma membrane-type-like (LOC111411632), mRNA. ACCESSION XM_023042150 VERSION XM_023042150.1 DBLINK BioProject: PRJNA417827 KEYWORDS RefSeq. SOURCE Olea europaea var. sylvestris ORGANISM Olea europaea var. sylvestris Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Oleaceae; Oleeae; Olea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_036238.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Olea europaea var. sylvestris Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..360 /organism="Olea europaea var. sylvestris" /mol_type="mRNA" /variety="sylvestris" /sub_species="europaea" /db_xref="taxon:158386" /chromosome="2" /clone="OG-1" /tissue_type="leaf" /country="Turkey: Bursa, Orhangazi" gene 1..360 /gene="LOC111411632" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:111411632" CDS 79..345 /gene="LOC111411632" /codon_start=1 /product="calcium-transporting ATPase 5, plasma membrane-type-like" /protein_id="XP_022897918.1" /db_xref="GeneID:111411632" /translation="
MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVDVFACGKKIEPPDNKSLLPPNVMSLLLEGISQNTTGSIYVPEVGYC"
misc_feature <79..>309 /gene="LOC111411632" /note="plasma-membrane calcium-translocating P-type ATPase; Region: ATPase-IIB_Ca; TIGR01517" /db_xref="CDD:273668" ORIGIN
actgttgcagtgaccattgtagttgttgcagtacctgaagggcttccattggctgtcactctgacgcttgcctattcaatgagaaaaatgatggcagacaaggccttggtcaggaggctatcagcctgtgaaaccatgggctctgcaacaactatttgcagcgataaaaccgggaccctaactttgaatgagatgactgtggttgatgtgtttgcttgtgggaagaagattgaaccccctgacaataagtcactgcttcctcctaatgttatgtctctgcttcttgaaggcatttcacagaatacaactggcagcatatatgtccctgaggtgggttattgctaaatagcaaccatttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]