GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:30:32, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_022772423             303 bp    mRNA    linear   PLN 06-OCT-2017
DEFINITION  Lachancea lanzarotensis LALA0S05e07514g1_1 (LALA0_S05e07514g),
            partial mRNA.
ACCESSION   XM_022772423
VERSION     XM_022772423.1
DBLINK      BioProject: PRJNA413304
            BioSample: SAMEA3170909
KEYWORDS    RefSeq.
SOURCE      Lachancea lanzarotensis
  ORGANISM  Lachancea lanzarotensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2
  AUTHORS   Neuveglise,Cecile.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2014) INRA UMR 1319, INRA UMR 1319, Institut
            Micalis, Bat. CBAI, Thiverval-Grignon, 78850, France
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_019212883).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Lachancea lanzarotensis"
                     /mol_type="mRNA"
                     /strain="CBS 12615"
                     /db_xref="taxon:1245769"
                     /chromosome="Unknown"
     gene            <1..>303
                     /locus_tag="LALA0_S05e07514g"
                     /db_xref="GeneID:34685992"
     CDS             1..303
                     /locus_tag="LALA0_S05e07514g"
                     /standard_name="LALA0S05e07514g1_1"
                     /note="highly similar to uniprot|O14455 Saccharomyces
                     cerevisiae YPL249C-A (ohnolog of YMR194W) RPL36B Protein
                     component of the large (60S) ribosomal subunit, nearly
                     identical to Rpl36Ap and has similarity to rat L36
                     ribosomal protein; binds to 5.8 S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022628748.1"
                     /db_xref="GeneID:34685992"
                     /translation="
MAVKSGIATGLNKGKKVNAMTPTPKISYRKGASSNRTKFVRSLVKEVAGLAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNDIITASRRH"
     misc_feature    10..297
                     /locus_tag="LALA0_S05e07514g"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:307352"
ORIGIN      
atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcaacgccatgaccccaaccccaaagatctcctacagaaagggtgcttcttccaacagaaccaagttcgtcagatctttggtcaaggaagttgccggtttggccccatacgaaagaagattgatcgatttgatcagaaacgctggtgaaaagagagccagaaaggtggccaagaagagattgggtaccttcggcagagccaaggccaaggtcgaggagatgaacgacatcatcaccgcttctcgtcgtcattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]