LOCUS       XM_022621404             309 bp    mRNA    linear   PLN 25-FEB-2022
DEFINITION  Colletotrichum orchidophilum uncharacterized protein
            (CORC01_09775), partial mRNA.
ACCESSION   XM_022621404
VERSION     XM_022621404.1
DBLINK      BioProject: PRJNA411788
            BioSample: SAMN05771038
KEYWORDS    RefSeq.
SOURCE      Colletotrichum orchidophilum
  ORGANISM  Colletotrichum orchidophilum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae;
            Colletotrichum.
REFERENCE   1  (bases 1 to 309)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 309)
  AUTHORS   Baroncelli,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2016) Laboratoire Universitaire de Biodiversite
            et Ecologie Microbienne, University of Western Brittany, Avenue du
            Technopole, Plouzane, Brest 29280, France
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_019173046).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..309
                     /organism="Colletotrichum orchidophilum"
                     /mol_type="mRNA"
                     /strain="IMI 309357"
                     /host="Phalaenopsis sp."
                     /db_xref="taxon:1209926"
                     /chromosome="Unknown"
                     /country="United Kingdom"
                     /collection_date="1986"
     gene            <1..>309
                     /locus_tag="CORC01_09775"
                     /db_xref="GeneID:34562914"
     CDS             1..309
                     /locus_tag="CORC01_09775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022472143.1"
                     /db_xref="GeneID:34562914"
                     /translation="

MSESWEEMDEVDEVDEVDEAQLMDVRLLAPSLGSGKGSTYRRRAPDPLAGNRHVSRAVRPGVPSYQLSSLDERPTRASASFSLPYDAALQLPPFSVFNSFLD"

ORIGIN      

atgtctgagtcgtgggaggagatggacgaggtggacgaggtagacgaggtagacgaagcccagttgatggatgtgaggttgcttgcgccttccttggggtccggcaaaggctccacctaccgtcgccgtgccccggatccgttggccggaaacaggcacgtatcgcgtgccgtgcgcccgggcgtgccttcctaccagctttcgtctcttgacgagaggcctaccagggcctcggcgtccttctccctcccgtacgacgctgccctccagcttccgcccttctcagtcttcaactcatttctcgactga

//