GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-17 17:26:04, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_022601045             318 bp    mRNA    linear   PLN 04-FEB-2020
DEFINITION  Kuraishia capsulata CBS 1993 uncharacterized protein
            (KUCA_T00004322001), partial mRNA.
ACCESSION   XM_022601045
VERSION     XM_022601045.1
DBLINK      BioProject: PRJNA264007
            BioSample: SAMEA3138920
KEYWORDS    RefSeq.
SOURCE      Kuraishia capsulata CBS 1993
  ORGANISM  Kuraishia capsulata CBS 1993
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Pichiales; Pichiaceae; Kuraishia.
REFERENCE   1
  AUTHORS   Morales,L., Noel,B., Porcel,B., Marcet-Houben,M., Hullo,M.-F.,
            Sacerdot,C., Tekaia,F., Leh-Louis,V., Despons,L., Khanna,V.,
            Aury,J.-M., Barbe,V., Couloux,A., Labadie,K., Pelletier,E.,
            Souciet,J.-L., Boekhout,T., Gabaldon,T., Wincker,P. and Dujon,B.
  TITLE     Complete DNA sequence of /Kuraishia capsulata/ illustrates novel
            genomic features among budding yeasts (/Saccharomycotina/)
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 318)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 318)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2013) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex -FRANCE (E-mail : seqref@genoscope.cns.fr -
            Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_019172954).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..318
                     /organism="Kuraishia capsulata CBS 1993"
                     /mol_type="mRNA"
                     /strain="CBS 1993"
                     /type_material="culture from type material of Hansenula
                     capsulata"
                     /db_xref="taxon:1382522"
                     /chromosome="Unknown"
                     /note="Kuraishia_capsulata_scaffold_5"
     gene            <1..>318
                     /locus_tag="KUCA_T00004322001"
                     /db_xref="GeneID:34521718"
     CDS             1..318
                     /locus_tag="KUCA_T00004322001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022460330.1"
                     /db_xref="GeneID:34521718"
                     /db_xref="GOA:W6MX63"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:W6MX63"
                     /translation="
MIQQRFEVEDSIAAGVNKGHKVTAKEVAPKISYRKGALSKRTAFVRDIVREVSGLAPYERRVIELIRNAGEKRAKKLAKKRLGTHLRAKAKVEEMNKIIQESRRH"
     misc_feature    34..312
                     /locus_tag="KUCA_T00004322001"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atgatacaacaacgctttgaggttgaagacagtatcgccgctggtgttaacaagggtcacaaagtgaccgctaaggaggttgccccaaaaatctcgtacagaaagggtgctttgtccaagagaaccgccttcgtcagagacattgtccgtgaagtgtccggtttggctccatacgagagacgtgtcattgagttgatcagaaatgctggtgagaagcgtgccaagaagctggccaagaagagattgggaactcacttgagagccaaggccaaggttgaggagatgaacaagatcatccaagagtctagacgtcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]