2024-04-20 19:54:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_022452009 406 bp mRNA linear INV 14-SEP-2017 DEFINITION PREDICTED: Crassostrea virginica uncharacterized LOC111113719 (LOC111113719), mRNA. ACCESSION XM_022452009 VERSION XM_022452009.1 DBLINK BioProject: PRJNA379157 KEYWORDS RefSeq; includes ab initio. SOURCE Crassostrea virginica (eastern oyster) ORGANISM Crassostrea virginica Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae; Crassostrea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_035788.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Crassostrea virginica Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 19% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..406 /organism="Crassostrea virginica" /mol_type="mRNA" /isolate="RU13XGHG1-28" /isolation_source="Rutgers Haskin Shellfish Research Laboratory inbred lines (NJ)" /db_xref="taxon:6565" /chromosome="9" /tissue_type="whole sample" /country="USA" /collection_date="22-Mar-2015" gene 1..406 /gene="LOC111113719" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 84% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111113719" CDS 71..406 /gene="LOC111113719" /codon_start=1 /product="uncharacterized protein LOC111113719" /protein_id="XP_022307717.1" /db_xref="GeneID:111113719" /translation="
MTSIVEDINDRHMKPWAEACQRDGIDNTPLNPFIDQELLYNKNLSLDSAKLKGTGFTYSIPELKIDSLREILDDYIKCGLFPRSLLSAEMLWNCEAEHEETEEILANQNGS"
ORIGIN
ctgccatctgcatgattgaggacgagtttgtgagattgaacttgtgttgtttaaaggaaaacaggtcaacatgacctccattgtagaagacatcaatgatcgtcacatgaagccctgggctgaagcttgtcagagggacggcatagacaacacgccgctcaaccccttcatagaccaggaactgttatacaataagaatctatctttagacagtgccaaactcaaggggactggatttacttatagtataccagagctaaaaatagattcactcagagagattttagatgattatatcaaatgtggactttttcctcgatcgctcttatcagcggaaatgttgtggaactgcgaggctgaacatgaagagacagaggaaattctagctaatcaaaatggttcctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]