ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-21 12:32:55, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_021443097 417 bp mRNA linear PLN 09-JUN-2017
DEFINITION PREDICTED: Herrania umbratica uncharacterized LOC110427542
(LOC110427542), mRNA.
ACCESSION XM_021443097
VERSION XM_021443097.1
DBLINK BioProject: PRJNA389730
KEYWORDS RefSeq; includes ab initio.
SOURCE Herrania umbratica
ORGANISM Herrania umbratica
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae;
Herrania.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_018397275.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Herrania umbratica Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.4
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..417
/organism="Herrania umbratica"
/mol_type="mRNA"
/cultivar="Fairchild"
/db_xref="taxon:108875"
/chromosome="Unknown"
/tissue_type="leaf"
/dev_stage="mature"
/geo_loc_name="USA: Fairchild Tropical Gardens, Miami, FL"
/collection_date="2016-10"
/collected_by="Dayana Rodezno"
gene 1..417
/gene="LOC110427542"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:110427542"
CDS 1..417
/gene="LOC110427542"
/codon_start=1
/product="uncharacterized protein LOC110427542"
/protein_id="XP_021298772.1"
/db_xref="GeneID:110427542"
/translation="
MAECSSIRPHVLKMIELIERLGQLGLAMDHELSIDLVLQSLLDSFSQFMLNFHMNRLEATFLELLNMLNMVEWSIRKDKGSLLLVSSFEAHTKQQKKKAQKGKKVKSQNEKVLKPKRGVKKDKEKDILPSLWQTWALE"
misc_feature <1..>144
/gene="LOC110427542"
/note="gag-polypeptide of LTR copia-type; Region:
Retrotran_gag_2; pfam14223"
/db_xref="CDD:464108"
ORIGIN
atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]