2024-05-20 09:23:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021295168 1064 bp mRNA linear VRT 24-MAY-2017 DEFINITION PREDICTED: Columba livia ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (ST6GALNAC5), transcript variant X1, mRNA. ACCESSION XM_021295168 VERSION XM_021295168.1 DBLINK BioProject: PRJNA217047 KEYWORDS RefSeq. SOURCE Columba livia (rock pigeon) ORGANISM Columba livia Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004973463.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Columba livia Annotation Release 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1064 /organism="Columba livia" /mol_type="mRNA" /db_xref="taxon:8932" /chromosome="Unknown" /sex="male" /tissue_type="blood" /country="Denmark: Vordingborg" /collection_date="13-Jun-2010" /breed="Danish Tumbler" /note="bred by Anders Christiansen, Hans Ove Christiansen, and certified by Danmarks Racedueforeninger" gene 1..1064 /gene="ST6GALNAC5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:102098304" CDS 123..875 /gene="ST6GALNAC5" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 isoform X1" /protein_id="XP_021150843.1" /db_xref="GeneID:102098304" /translation="
MHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSVRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCSVQQRNREEPSSESFPAAEGGSQPNLPGAVRAELGPQHLPDFYCVGSKSVGDNDFNFTNPPSSTDLPLRPLPASVQKGRAG"
misc_feature 126..623 /gene="ST6GALNAC5" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
ggaggccgggtcagtaagtctgcctggtgtagttcgagacatgcttgttagcttgaatttggaagcagaatagacacagtgtatctgagcacgtaaatcctgacctttggcagcctttaaaaatgcactgcaagagttgtgcgttggtaaccagctctggacaccttctgggaagtaaacaaggtgacagaatcgacgagaccgagtgtgtaatacgaatgaacgatgcacctactcgaggttacggaaaagatgttggaaacaaaacgagcgttcgagtcattgcacactccagtattcagaggattttgcggaatcgcaatgaactcttaaatatgagccacggtgctgtgtttatcttctggggtcccagcagctacatgaggagagatggtaaaggcttggtgtataataacctccagctgatgaatcagatactgcctcaattaaaagcatatatgatttctcgccacaagatgcttcaatttgatgacctttttaaacgggaaactgggaaagacaggaagatctccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagcgtacagcaaaggaatagggaagagccatccagcgaatcatttcctgcagcagaggggggatcccagccaaacctacctggtgctgtgagggcagaactgggccctcagcacttacctgatttctactgcgttggttcaaagtctgttggagataacgatttcaacttcactaatccaccaagcagcacagatttacccttgagaccacttccagcttcagtgcagaaaggaagagcaggctaaacgagacacagaggcctatttgtttagtggttcttaagaaaaacacaaatcacataaatgtatcttgttagatttacagtaaccatacatatgatttgtttaagagattataacaattgtccaatgtatcaaaaaagtatgtgaaaaattaattgaagatttagatttaatagttctagctaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]