2024-05-20 10:23:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021124052 455 bp mRNA linear PLN 13-MAY-2017 DEFINITION PREDICTED: Arachis ipaensis uncharacterized LOC110272166 (LOC110272166), mRNA. ACCESSION XM_021124052 VERSION XM_021124052.1 DBLINK BioProject: PRJNA316874 KEYWORDS RefSeq; includes ab initio. SOURCE Arachis ipaensis ORGANISM Arachis ipaensis Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; dalbergioids sensu lato; Dalbergieae; Pterocarpus clade; Arachis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_029789.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Arachis ipaensis Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 11% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..455 /organism="Arachis ipaensis" /mol_type="mRNA" /cultivar="K30076" /db_xref="taxon:130454" /chromosome="B05" /tissue_type="whole plant" /country="Bolivia: Tarija, Quebrada de Thaiguate (30 km N of Villa Montes)" /collection_date="2012" gene 1..455 /gene="LOC110272166" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 90% coverage of the annotated genomic feature by RNAseq alignments, including 51 samples with support for all annotated introns" /db_xref="GeneID:110272166" CDS 96..455 /gene="LOC110272166" /codon_start=1 /product="uncharacterized protein LOC110272166" /protein_id="XP_020979711.1" /db_xref="GeneID:110272166" /translation="
MASRDQSEKLKWSSQLYEECHRYLASLNIEYHPFIMRPSAGSSFDGLEKSIVEIETRLEVGEPPNDKGTECSSNAGGAPSDLEDLSNGDGVNDSQEPKVDVNGNTEEKRRHFVEKMRGP"
ORIGIN
aaaacaacaaatctgtggtgtaccatggaagcaaattgctttacatatatcttgagacgtcatgtgaaaaagaagcatggtgtaaggccctccgtatggcttcacgcgatcagagtgaaaaacttaagtggtctagtcagttgtatgaagagtgtcatcgatatctagcatcactaaatattgaatatcatccttttatcatgagaccatcagcaggatcaagttttgatggcttagaaaagtccatagtagagattgaaacaaggcttgaagttggtgaaccaccgaacgataaggggacggaatgctcaagcaatgctgggggtgccccgtcagatcttgaagatcttagcaatggagacggagtgaatgattcacaagagccaaaagtagatgtcaatgggaacactgaagaaaagaggcgtcactttgttgaaaagatgagaggaccatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]