GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-15 14:42:53, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_020597641            3372 bp    mRNA    linear   VRT 12-JUN-2025
DEFINITION  PREDICTED: Monopterus albus argonaute RISC component 4 (ago4),
            mRNA.
ACCESSION   XM_020597641
VERSION     XM_020597641.1
DBLINK      BioProject: PRJNA380265
KEYWORDS    RefSeq.
SOURCE      Monopterus albus (swamp eel)
  ORGANISM  Monopterus albus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Anabantaria; Synbranchiformes; Synbranchidae;
            Monopterus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018127914.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_001952655.1-RS_2025_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/12/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3372
                     /organism="Monopterus albus"
                     /mol_type="mRNA"
                     /db_xref="taxon:43700"
                     /chromosome="Unknown"
                     /sex="male"
                     /geo_loc_name="China"
     gene            1..3372
                     /gene="ago4"
                     /note="argonaute RISC component 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins, and 99% coverage of the annotated genomic
                     feature by RNAseq alignments"
                     /db_xref="GeneID:109958748"
     CDS             275..2866
                     /gene="ago4"
                     /codon_start=1
                     /product="protein argonaute-4"
                     /protein_id="XP_020453297.1"
                     /db_xref="GeneID:109958748"
                     /translation="
MEALGPGPPAPTSLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDIDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDLEVTLPGEGKDQTFKVSLQWVSVVSLQMLLEALSGHLNEVPEDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVSAXSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFKHLKMSYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDMSQEQLFSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRDPQALAKAVQIHYDTQHTMYFA"
     misc_feature    356..745
                     /gene="ago4"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:465134"
     misc_feature    776..928
                     /gene="ago4"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:462567"
     misc_feature    929..1291
                     /gene="ago4"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(1085..1087,1130..1132,1172..1174,1184..1186,
                     1238..1240,1259..1261,1265..1267)
                     /gene="ago4"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1430..2737
                     /gene="ago4"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1841..1843,1853..1855,1889..1900,1907..1909,
                     1931..1933,1940..1942,1952..1954,1964..1966)
                     /gene="ago4"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
     misc_feature    order(2045..2047,2051..2053,2291..2293,2705..2707)
                     /gene="ago4"
                     /note="active site"
                     /db_xref="CDD:240015"
ORIGIN      
atatattggtcttcactcacagtgcggcacagcaaattacgcatgcgcacagcgagctccacgtctaaccggcgcatgcgctctttcaaaccctcagaaccagcaaacaacggcagtagctcaggtcagtcggtccagtcagtaggcatccacgcgtctatctatattcccttttcttaaattagtcactttaagcttcgcgataccgcccccaatttcagtgtcggtacggagccgccaggccgggacagagacggagagagaggcctcggccatggaagcgctcggacccggcccgcctgcccctacctctctgtttcagcctccgcggcgtcctggcctcggcacagtggggaaacccatccggctccttgccaaccacttccaggtgcagattcccaagattgatgtctatcactatgatatcgacatcaagcctgagaaacggcctcggagggtcaacagggaggtggtggacaccatggtgcggcacttcaagatgcagatctttggagaccgacagcctggctacgatgggaagaggaacatgtacacagcacatccactgccaatagggagagacagggtggatttggaggtgaccctgcctggcgaggggaaggatcagacgttcaaagtgtctttgcagtgggtgtctgtggtcagtcttcagatgctgctggaagccctgtcaggtcacctcaacgaggtaccagaggactccgtgcaggctctagatgtcatcacacggcatctgccttccatgaggtacactccagtggggcgttcatttttctcccccccagagggctattaccatcctcttggtggaggcagagaggtgtggtttggtttccatcagtctgtgcgtcctgccatgtggaacatgatgctcaacattgatgtgtcagccactgctttctaccgtgctcagcctgtgatagagttcatgtgtgaggtgcttgatatacagaacatcaacgaacagaccaaaccactgactgactctcagcgcgtcaaattcaccaaggaaataagaggcttgaaagttgaggtgacacactgtggacagatgaagaggaagtatcgtgtgtgcaatgtcacgcgtcgacctgccagccaccaaacgttccccttacagcttgagaatggccaagccatggagtgcacagtagctcagtatttcaagcaaaagtacaacctgcagctcaagtatccacatttaccctgtttacaagtagggcaggagcagaagcacacctaccttcccctggaggtctgtaacatagtggcaggccagcgctgtatcaaaaaactgactgacaaccagacatccaccatgattaaagctacagctcgctctgcccccgacagacaggaagagatcagcagactggtgagtgcnnnnagcatggttgggggcccagacccttacctgaaggaatttggcattgttgtgcacaatgacatgacagaggtgacggggcgtgtcctcccagcgcccatgctacagtatgggggccggaataaaacggtggccacgcccaaccagggcgtgtgggacatgagagggaagcagttctacgctggcatcgagatcaaggtctgggctgtggcctgctttgccccacagaaacagtgccgggaggacctgctcaagagtttcactgaccaactgcgaaagatctccaaggatgctggcatgcctattcagggccagccatgtttctgtaaatacgcccaaggagctgacagtgtggagcctatgttcaaacacctcaaaatgtcttatgtaggtctgcagctgattgtcgtcatcctgcctggcaaaacaccggtctatgctgaagtgaagcgggtaggtgacaccctcctcggcatggccactcagtgtgtgcaggtgaagaacgtggtgaagacgtccccacaaaccctctccaacctctgcctcaagatcaacgccaagctgggaggcatcaacaacgtcctggtgcctcatcaacggccatctgtgttccagcagccggtcatcttcctgggcgctgatgtgacacaccctccagcaggtgatgggaagaagccgtccattgcggcagtggtgggcagcatggatggccaccccagccgctactgtgcgacagtacgagtccagacatctcgacaagacatgtcccaggagcagctgttcagccaggaggtaatccaagacttgacgaacatggtgcgtgagttgctcatccagttctacaagtctacacgcttcaagcccacacgcatcatctactatcgtggtggtgtttctgagggacaaatgaaacaggtggcatggccggagctgatagccatccggaaggcatgtatcagtctggaggaggattacaggcctggtattacctacattgtggtccagaaacgtcaccacactcggctgttctgctctgataaagctgagagggtggggaagagtggtaatgtcccagctggcaccacagtggacagcaccatcacgcacccgtccgagtttgacttctatctgtgcagccatgctgggattcagggaaccagtcgtccctcccactaccacgtcctgtgggatgacaactgtttcacagcggatgaactgcagcttctcacctaccagctgtgccacacctatgtccgctgcacacgctctgtttccattccagcaccagcctattacgccaggctagtggcttttcgagcccgctaccacctggtggacaaagaccatgacagtgctgaaggcagccatgtgtcgggccagagtaacggccgggacccacaagcattggccaaggcagttcagatccactatgatacccagcacaccatgtactttgcctgagctagcaagcacatcagccagtcaacctatggattccctttctttctgtctttttatctatttaccagtttctcctcttcagtgtctctctgcctccttgtagtctttctcctcgttctcactctacatttctgaatctgcaccaaaggggctcttggacaggagagtctgcggtaactcggatgtccagcaggttcttttttatggaacaatctccaaccagcgttcccagtcgagccaccttcctaaccagcgatccgccactgtgaaccctgatggttctcagtgcacaaaagaaaaaaaaacttgaaaaaacaaaaacaaaccacacacatacaagttgagccattattttgagtttgtttttgttttttctgtttgaatgtctgcactcttgtgtttaagatacactgagcgagggagtggattggcacagtctgtgtcagcgcagctctttagctctcccagctaagcaggactcttatctacttttacctcaaagccct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]