GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 04:44:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_020408330             983 bp    mRNA    linear   PLN 01-MAR-2017
DEFINITION  PREDICTED: Asparagus officinalis uncharacterized protein
            DDB_G0279979-like (LOC109839882), mRNA.
ACCESSION   XM_020408330
VERSION     XM_020408330.1
DBLINK      BioProject: PRJNA376608
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Asparagus officinalis (garden asparagus)
  ORGANISM  Asparagus officinalis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Asparagales;
            Asparagaceae; Asparagoideae; Asparagus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_033798.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Asparagus officinalis Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..983
                     /organism="Asparagus officinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:4686"
                     /chromosome="5"
                     /sex="male"
                     /tissue_type="Spear"
                     /dev_stage="Mature"
                     /country="Netherlands"
                     /genotype="DH0086"
     gene            1..983
                     /gene="LOC109839882"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 98% coverage of the annotated
                     genomic feature by RNAseq alignments, including 13 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:109839882"
     CDS             57..983
                     /gene="LOC109839882"
                     /codon_start=1
                     /product="uncharacterized protein DDB_G0279979-like"
                     /protein_id="XP_020263919.1"
                     /db_xref="GeneID:109839882"
                     /translation="
MAKHIDVAFDDEEEINVLPIEQQLTFWRNSAKFLKRLLDATKQTKSNYCKEFMIEINRLNRIIEKCGRHDEVIDPVLLKSNIKQKIANEIRKKRQGAQEEQKSKTSSVYKEEPTSQEHVHKIVEEDVKHLADDEAIEEEPVTSPGEGVYSKVDQTVDTKVDDSVNKEEEHMQHIVDMEEEHMEHIVDMEEEHMVDKEEEHMEDIVDNEEERMVDKEEEYMVDKEEEHMENENFIVDNKGFDEDTVDGVDKEEDIVDKGKENVDKLEAQEEEDLVNIEHNVDKLVDVLTSNVKAKRRPKAKRVSRRSKC"
     misc_feature    <294..911
                     /gene="LOC109839882"
                     /note="Ring-infected erythrocyte surface antigen;
                     Provisional; Region: PTZ00341"
                     /db_xref="CDD:173534"
ORIGIN      
caaagaggaaggctttgcaggaagaaactactaagaacttctcaataggttacatcatggcaaagcatattgacgttgcttttgacgatgaagaggagatcaatgttcttcccattgagcagcaactcacattttggagaaattctgctaaatttctcaagcgacttcttgatgctacaaagcagaccaagagcaattattgtaaagaattcatgattgagatcaacaggcttaacaggataattgaaaaatgtggaagacatgatgaggttatagacccagtgctgcttaagtcaaatatcaaacagaaaattgcaaatgaaattaggaagaagcgacagggagctcaagaggaacagaagtccaaaacaagcagtgtatataaggaagagcccaccagtcaagaacatgtacataagattgttgaagaggatgtaaagcatcttgctgacgatgaggcaatagaagaggagccagttacttctccaggggagggggtatatagtaaggttgaccagactgtagatactaaggttgatgatagtgtaaataaggaagaggagcatatgcaacatattgtagatatggaagaggagcatatggaacatattgtagatatggaagaggagcatatggtagataaggaagaggagcatatggaagatattgtagataatgaagaggagcgtatggtagataaggaagaggagtatatggtagacaaggaagaggagcatatggaaaatgaaaattttattgtagataacaaaggttttgatgaggatactgttgatggtgtagataaggaggaagatattgtagataaaggcaaggagaatgtagataagttggaagcacaggaggaagaggatcttgtgaatattgaacataatgtggacaaacttgtagatgttctaacgagcaatgtgaaagcaaagcgtagaccaaaggcaaaaagggtaagcaggagatctaaatgttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]