2024-04-27 04:44:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_020408330 983 bp mRNA linear PLN 01-MAR-2017 DEFINITION PREDICTED: Asparagus officinalis uncharacterized protein DDB_G0279979-like (LOC109839882), mRNA. ACCESSION XM_020408330 VERSION XM_020408330.1 DBLINK BioProject: PRJNA376608 KEYWORDS RefSeq; includes ab initio. SOURCE Asparagus officinalis (garden asparagus) ORGANISM Asparagus officinalis Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Asparagales; Asparagaceae; Asparagoideae; Asparagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_033798.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Asparagus officinalis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..983 /organism="Asparagus officinalis" /mol_type="mRNA" /db_xref="taxon:4686" /chromosome="5" /sex="male" /tissue_type="Spear" /dev_stage="Mature" /country="Netherlands" /genotype="DH0086" gene 1..983 /gene="LOC109839882" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 98% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns" /db_xref="GeneID:109839882" CDS 57..983 /gene="LOC109839882" /codon_start=1 /product="uncharacterized protein DDB_G0279979-like" /protein_id="XP_020263919.1" /db_xref="GeneID:109839882" /translation="
MAKHIDVAFDDEEEINVLPIEQQLTFWRNSAKFLKRLLDATKQTKSNYCKEFMIEINRLNRIIEKCGRHDEVIDPVLLKSNIKQKIANEIRKKRQGAQEEQKSKTSSVYKEEPTSQEHVHKIVEEDVKHLADDEAIEEEPVTSPGEGVYSKVDQTVDTKVDDSVNKEEEHMQHIVDMEEEHMEHIVDMEEEHMVDKEEEHMEDIVDNEEERMVDKEEEYMVDKEEEHMENENFIVDNKGFDEDTVDGVDKEEDIVDKGKENVDKLEAQEEEDLVNIEHNVDKLVDVLTSNVKAKRRPKAKRVSRRSKC"
misc_feature <294..911 /gene="LOC109839882" /note="Ring-infected erythrocyte surface antigen; Provisional; Region: PTZ00341" /db_xref="CDD:173534" ORIGIN
caaagaggaaggctttgcaggaagaaactactaagaacttctcaataggttacatcatggcaaagcatattgacgttgcttttgacgatgaagaggagatcaatgttcttcccattgagcagcaactcacattttggagaaattctgctaaatttctcaagcgacttcttgatgctacaaagcagaccaagagcaattattgtaaagaattcatgattgagatcaacaggcttaacaggataattgaaaaatgtggaagacatgatgaggttatagacccagtgctgcttaagtcaaatatcaaacagaaaattgcaaatgaaattaggaagaagcgacagggagctcaagaggaacagaagtccaaaacaagcagtgtatataaggaagagcccaccagtcaagaacatgtacataagattgttgaagaggatgtaaagcatcttgctgacgatgaggcaatagaagaggagccagttacttctccaggggagggggtatatagtaaggttgaccagactgtagatactaaggttgatgatagtgtaaataaggaagaggagcatatgcaacatattgtagatatggaagaggagcatatggaacatattgtagatatggaagaggagcatatggtagataaggaagaggagcatatggaagatattgtagataatgaagaggagcgtatggtagataaggaagaggagtatatggtagacaaggaagaggagcatatggaaaatgaaaattttattgtagataacaaaggttttgatgaggatactgttgatggtgtagataaggaggaagatattgtagataaaggcaaggagaatgtagataagttggaagcacaggaggaagaggatcttgtgaatattgaacataatgtggacaaacttgtagatgttctaacgagcaatgtgaaagcaaagcgtagaccaaaggcaaaaagggtaagcaggagatctaaatgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]