LOCUS       XM_020265802            1101 bp    mRNA    linear   PLN 28-AUG-2017
DEFINITION  Talaromyces atroroseus Protein disulfide-isomerase tigA
            (UA08_03495), partial mRNA.
ACCESSION   XM_020265802
VERSION     XM_020265802.1
DBLINK      BioProject: PRJNA374571
            BioSample: SAMN03339010
KEYWORDS    RefSeq.
SOURCE      Talaromyces atroroseus
  ORGANISM  Talaromyces atroroseus
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            Talaromyces; Talaromyces sect. Trachyspermi.
REFERENCE   1  (bases 1 to 1101)
  AUTHORS   Rasmussen,K.B., Rasmussen,S., Petersen,B., Sicheritz-Ponten,T.,
            Mortensen,U.H. and Thrane,U.
  TITLE     Talaromyces atroroseus IBT 11181 draft genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1101)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1101)
  AUTHORS   Rasmussen,K.B., Rasmussen,S., Petersen,B., Sicheritz-Ponten,T.,
            Mortensen,U.H. and Thrane,U.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUN-2015) DTU Systems Biology, Technical University
            of Denmark, Soeltofts Plads 223, Kgs. Lyngby 2800, Denmark
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_017971435).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1101
                     /organism="Talaromyces atroroseus"
                     /mol_type="mRNA"
                     /strain="IBT 11181"
                     /isolation_source="plant fruit food product"
                     /host="Capsicum annuum"
                     /db_xref="taxon:1441469"
                     /chromosome="Unknown"
                     /geo_loc_name="Denmark"
                     /lat_lon="55.77198 N 12.50519 E"
                     /collection_date="17-Dec-1990"
     gene            <1..>1101
                     /locus_tag="UA08_03495"
                     /db_xref="GeneID:31003250"
     CDS             1..1101
                     /locus_tag="UA08_03495"
                     /note="GO_component: GO:0005783 - endoplasmic reticulum;
                     GO_function: GO:0016853 - isomerase activity; GO_process:
                     GO:0008152 - metabolic process; GO_process: GO:0045454 -
                     cell redox homeostasis"
                     /codon_start=1
                     /product="Protein disulfide-isomerase tigA"
                     /protein_id="XP_020121592.1"
                     /db_xref="GeneID:31003250"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /translation="

MARLSFIVSCLALFVSIVSAASAVLDLLPSNFDKIAVNSGKFTMVEFFAPWCGHCKNLAPVYEELAQAFAFSDKIQIAKVDADEHRDLGKAYNIQGFPTIKYFDGKSSKAQEYDGGRDIEALTAFVTEKTGVRPKSVQKPASSVEMLTESTFKDFVGTDKNVFVAFTAPWCGHCKKLAPTWEDLAVDFARDENVVIAKVDCEAENSKSLAKEFGVTGYPSIKFFPAGSSEPVTYQGGRSEEVFVKYINEQVGTHRVVGGGLDEKAGTIPTLDSLVAKYVPTKSFVKLSEEITKTAKNLQEQYVQYYIRVTDKLKESEGYVTKEIARLGKILSKGGLAPEKVDDLTSRSNILRQFLGGETEETKDEL"

     misc_feature    67..378
                     /locus_tag="UA08_03495"
                     /note="PDIa family, endoplasmic reticulum protein 38
                     (ERp38) subfamily; composed of proteins similar to the
                     P5-like protein first isolated from alfalfa, which
                     contains two redox active TRX (a) domains at the
                     N-terminus, like human P5, and a C-terminal domain...;
                     Region: PDI_a_ERp38; cd02998"
                     /db_xref="CDD:239296"
     misc_feature    order(154..156,163..165,349..351)
                     /locus_tag="UA08_03495"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239296"
     misc_feature    439..753
                     /locus_tag="UA08_03495"
                     /note="protein disulfide-isomerase domain; Region:
                     pdi_dom; TIGR01126"
                     /db_xref="CDD:273454"
     misc_feature    order(511..513,520..522,712..714)
                     /locus_tag="UA08_03495"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239296"
     misc_feature    796..1062
                     /locus_tag="UA08_03495"
                     /note="Endoplasmic reticulum protein ERp29, C-terminal
                     domain; Region: ERp29; pfam07749"
                     /db_xref="CDD:462253"
ORIGIN      

atggctcgcttgagcttcatcgtgagctgtctcgcgctcttcgtgagcattgttagcgctgcgtccgccgttcttgacctgcttccctccaattttgataaaatcgccgtcaactccggaaaattcacaatggtcgagttctttgcaccctggtgtggtcactgcaagaaccttgcccccgtctatgaggaactcgcgcaggcgtttgcgttctccgacaagatccagatcgccaaggtggatgccgacgagcaccgtgatctaggaaaggcatacaacatccagggcttcccaacaatcaaatatttcgatggcaagagctctaaggcccaagagtacgacggtggtagggacattgaggccttgactgctttcgttactgagaagaccggtgttcgccccaagagcgttcaaaagccagctagcagcgttgagatgttgacggagtcaactttcaaagactttgttggtaccgataagaatgtttttgttgctttcactgctccttggtgtggacactgcaagaagcttgctccaacctgggaggaccttgccgtcgatttcgctcgcgatgagaacgtcgttattgctaaggttgactgcgaggccgagaactccaagtcccttgctaaggaattcggagtcacgggctacccaagcatcaagtttttccccgccggctcatctgagccggttacataccagggtggtcgctccgaggaagtcttcgtcaagtacatcaacgagcaagtcggaacccaccgtgttgtcggcggcggtcttgacgagaaggccggcactatccctacccttgactcgctcgttgccaagtacgtgcctaccaagagcttcgttaagctctcggaagagatcacgaagactgccaagaacctccaggagcagtatgtccagtactacatccgggtcactgataagttgaaggagagcgagggttacgtcaccaaggagattgctcgtttgggaaagattctttccaagggcggtcttgctcctgagaaggttgatgatttgacttctcgcagcaacattctccgtcaatttttgggaggtgagactgaagagaccaaggacgaactatag

//