GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 12:59:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_020152873            1809 bp    mRNA    linear   ROD 15-FEB-2017
DEFINITION  PREDICTED: Castor canadensis copper-transporting ATPase 2-like
            (LOC109676481), partial mRNA.
ACCESSION   XM_020152873
VERSION     XM_020152873.1
DBLINK      BioProject: PRJNA371604
KEYWORDS    RefSeq.
SOURCE      Castor canadensis (American beaver)
  ORGANISM  Castor canadensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Castorimorpha; Castoridae; Castor.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017882540.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Castor canadensis Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1809
                     /organism="Castor canadensis"
                     /mol_type="mRNA"
                     /isolate="Ward"
                     /db_xref="taxon:51338"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="Leukocyte"
                     /dev_stage="adult"
     gene            1..>1809
                     /gene="LOC109676481"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 12 Proteins, and 82%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:109676481"
     CDS             40..>1809
                     /gene="LOC109676481"
                     /codon_start=1
                     /product="copper-transporting ATPase 2-like"
                     /protein_id="XP_020008462.1"
                     /db_xref="GeneID:109676481"
                     /translation="
MKQSFAFDNVGYEGSLDGICSSPTTSSTISILGMTCQSCVKSIEDRISSLKGVVSIKVSLEQGSAAVKYVPSIMSLQQICHQVGDMGFEASIAEGRAASWPSRSSSAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVTDMGFEAAIKNKMAPLSLGPIDVSRLESTNPKRLSAFANQNFNNSETSKYQGNHVATLQLGIEGMHCKSCVLNIEGNIGQLSGVQNIQVSLENKTAQVQYDPSLITPLSLKRAIEALPPGNFKVSLPDGAEESGPETGSSEIPSHGSPQRNQMQDACRTVVLSVTGMTCASCVQSIEGTVSQREGVWQISVSLAEGTGTILYDPSVITPEELRAAVEDMGFEASVIPENYSTSHVRNDSAGNSMLQTTGSTLGSVKEVAPCVRVLPENHGPGHSSNTPPPTSTVAPQKCFLQVKGMTCASCVSNIERNLQKEAGILSVLVALMSGKAEVKYNPEVIQPPTIAQLIQDLGFEATVMEDNAGSDGDIELIITGMTCASCVHNIESRLTRTNGITYASVALATSKAHVKFDPEIIGPRDIVKIIE"
     misc_feature    136..312
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(139..147,154..156)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    376..567
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(394..402,409..411)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    718..894
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(736..744,751..753)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    1024..1215
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(1042..1050,1057..1059)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    1414..1602
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(1429..1437,1444..1446)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    1639..1809
                     /gene="LOC109676481"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(1657..1665,1672..1674)
                     /gene="LOC109676481"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
ORIGIN      
tctaaactttccttgcctgctcgtccctgggaaaaaccaatgaagcagagttttgcctttgacaatgttggctacgaagggagtctggatggcatatgctcctcaccaacgaccagcagcacaatcagcattctgggcatgacttgccagtcatgtgtcaagtccattgaggacaggatttctagtttgaaaggtgttgtgagcattaaggtttcactggaacaaggcagcgcagcagtgaaatatgtgccatccatcatgagcctgcaacagatttgccatcaagtcggggacatgggttttgaggccagcattgcagaaggaagggctgcctcctggccctcaaggtcctcatcagcccaggaggcagtggtcaagctccgggtagagggcatgacctgtcagtcctgtgtcagctccattgaaggcaaggtccggaaactgcaaggagtagtgagagtcaaagtctcccttagcaaccaagaggccgtcatcacttaccagccttatctcattcaacccgaagacctcagggaccatgtaactgacatgggatttgaagctgccatcaagaacaaaatggctcccttaagcctgggaccaattgacgtcagtcggttagaaagcactaacccaaagagattgtcagcttttgctaaccagaatttcaataactctgagacctcgaagtaccaaggaaaccatgtggccaccctccaactgggaatagagggaatgcattgtaaatcttgtgttttgaatattgaaggaaatataggccaactctcaggggttcaaaatattcaagtgtccttggagaacaaaactgcccaagtccagtatgacccttctcttatcacccctttgtccctaaagagggccattgaggcacttccacctgggaattttaaagtttctcttcctgatggagcagaagagagtgggccagagactggatcttctgagattccatcccatggctccccccagagaaaccagatgcaggatgcgtgcagaactgtggtgctgtccgtcactggcatgacctgtgcgtcctgtgtccagtccattgaaggcacagtctcccagcgggaaggggtgtggcaaatatcggtctctttggctgaagggactggaacgattctttatgatccctctgtaattacaccagaggaactccgagctgctgtagaagacatgggatttgaggcttcagtgattcctgaaaactattctaccagccatgttagaaatgacagtgctgggaattctatgctacaaactacaggcagcacacttgggtctgtgaaggaagtggctccctgtgtcagggtgctccctgagaaccacggtcctggccactcatcaaataccccaccacccaccagtacagtagccccacagaagtgctttttacaagtcaaaggcatgacctgtgcatcctgtgtgtctaacatagaaaggaatcttcagaaagaagctggtattctctctgtattggttgccttgatgtcgggaaaggcagaggtcaagtataatccagaggtcatccagccacccacaattgctcagctcatccaggacctgggctttgaggcaacagtcatggaagacaacgcaggctctgacggtgatatcgagctgattatcacggggatgacctgtgcttcctgtgttcacaacatagagtccagactcaccaggacaaatggcatcacctatgcctctgtagccctcgccaccagcaaagcccatgtgaagtttgatccagaaatcattggtccacgggatattgtgaaaattattgag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]