LOCUS       XM_019776568            1503 bp    mRNA    linear   INV 28-DEC-2016
DEFINITION  PREDICTED: Branchiostoma belcheri UPF0711 protein C18orf21 homolog
            (LOC109475800), mRNA.
ACCESSION   XM_019776568
VERSION     XM_019776568.1
DBLINK      BioProject: PRJNA358734
KEYWORDS    RefSeq.
SOURCE      Branchiostoma belcheri (Belcher's lancelet)
  ORGANISM  Branchiostoma belcheri
            Eukaryota; Metazoa; Chordata; Cephalochordata; Leptocardii;
            Amphioxiformes; Branchiostomatidae; Branchiostoma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017803965.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Branchiostoma belcheri Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1503
                     /organism="Branchiostoma belcheri"
                     /mol_type="mRNA"
                     /isolate="BF01"
                     /isolation_source="seawater"
                     /db_xref="taxon:7741"
                     /chromosome="Unknown"
                     /sex="male"
                     /cell_type="sperm cells"
                     /tissue_type="gonad"
                     /dev_stage="adult"
                     /country="China: Xiamen Bay"
                     /collection_date="Aug-2008"
                     /breed="outbred"
     gene            1..1503
                     /gene="LOC109475800"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:109475800"
     CDS             3..584
                     /gene="LOC109475800"
                     /codon_start=1
                     /product="UPF0711 protein C18orf21 homolog"
                     /protein_id="XP_019632127.1"
                     /db_xref="GeneID:109475800"
                     /translation="

MPDHMTCQSCGNLLLPGNHTVRLRPKRKMTSATRRVMSKVSKGQMASASEVKLLKKFQERKNHLVVQCSVCQGKAVIPAATRKHVVMATSTSHGSPAGTPVVSRRIAKATRRLVSTPHTSSSAFLSTPDSSTKVVGSSPGTPGSGLRVPGSSPGSSGRKGKQQKQRHAQLRHMLSQQSLGDTSTSLSDFLQSL"

     misc_feature    18..536
                     /gene="LOC109475800"
                     /note="Domain of unknown function (DUF4674); Region:
                     DUF4674; pfam15719"
                     /db_xref="CDD:434882"
ORIGIN      

acatgccagatcacatgacctgtcaatcatgtggtaacttgctgttgcctggcaaccacacagtgagattacgccctaagaggaagatgacctcagctacccgacgtgtcatgtcaaaggtcagcaagggtcaaatggcatcggcatcggaggtcaagctactaaagaaatttcaagaaaggaaaaaccacttggttgttcaatgttcagtctgtcagggaaaggcggtcatccctgcagccaccaggaaacacgttgtcatggcaacatcaacgtcacatggaagtccagcaggaactcctgtggtctccaggagaattgccaaggcaacccgaaggcttgtttcaactcctcacaccagcagttctgcatttctgagcaccccagactcgagtacaaaggttgtgggttcgagtcctggcactcctggatcaggtctgagggtcccgggttctagtcccggctcttcaggcaggaaaggcaagcagcagaaacagagacacgcccagctgagacacatgctatcccagcagtccttgggggacaccagtacttccctctccgactttctccagtctttatgacattttgtttgttttgcataactgataaacaagctttaggtgtaacacaacagttttgtactgtaagtacaagctgtgttaaactgggctgtaagtttgaaccactcacacagagaaggactcttttcaataacatggtcgaggtgtgactctcctcaaacatggggcctctggcattatgtcccttctgatccagaaggacatccctaaccaaagctagggaccatgtatgtgtaagaaatatgtgtatagaagatttattaggactttaaatgatgtaaatttttatctttttgatatacacgtacttgtatgttgtctgaccctcaccgaccaaatgaatgaatgagtgaatgaatgaatgaatggattaatgaatgaatggatgaatctcagacctccattaaatatttagaccttgtgtgatggtgactgtgtcctcttcccattcaccatggagtctacaagtctttctctattttgcaaggaaaataacaccagctgtcagctgcctagtaggtcaggtcacgaaaaacaacaaaaacagcaagcactaccagttctccctcagggacagatatccattacagcctcaaaaatttatgttttttcggtagttataagaagaatagttttttctttgtctgtaagtttagagaaatcgggatgaagtttgaatacatataccacggagtgacagatacattaccctcactttgtggcccataaatccttgatagtattctgggtatgttgtatgttctttcaaagacgtaagaaatgctatgttcgtgttacatctcgcaataaaccaaatagaacagtcataaaattgtgcccaagttgataaagacagtaaatgaatggagaacacaatgtcgtgatggtagataaagcaataaagtaaaccgtttcaaga

//