GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-25 21:53:32, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_019638725            1270 bp    mRNA    linear   MAM 20-DEC-2016
DEFINITION  PREDICTED: Hipposideros armiger homeobox B8 (HOXB8), transcript
            variant X2, mRNA.
ACCESSION   XM_019638725
VERSION     XM_019638725.1
DBLINK      BioProject: PRJNA357596
KEYWORDS    RefSeq.
SOURCE      Hipposideros armiger (great roundleaf bat)
  ORGANISM  Hipposideros armiger
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yinpterochiroptera;
            Rhinolophoidea; Hipposideridae; Hipposideros.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017731390.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Hipposideros armiger Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1270
                     /organism="Hipposideros armiger"
                     /mol_type="mRNA"
                     /isolate="ML-2016"
                     /db_xref="taxon:186990"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="muscle"
     gene            1..1270
                     /gene="HOXB8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 2 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:109380791"
     CDS             55..783
                     /gene="HOXB8"
                     /codon_start=1
                     /product="homeobox protein Hox-B8 isoform X2"
                     /protein_id="XP_019494270.1"
                     /db_xref="GeneID:109380791"
                     /translation="
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGSSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGDKK"
     misc_feature    490..660
                     /gene="HOXB8"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
gtggcgcccccaactacagtcgccgccgccgccgccgcctcaaaattcaataaaatgagctcttatttcgtcaactcactgttctccaaatacaaaaccggggagtccctgcgccccaattattatgactgcggcttcgcccaggacctgggcggccgacccaccgtggtgtacggtcccagcagcggcagcagttttcagcacccgtcgcaaatccaggagttctaccacgggccgtcgtcgctgtccacggctccctatcagcagaacccgtgcgccgtggcgtgccacggggaccccggcaacttctacggctacgacccgctgcagcggcagagcctgtttggtgcgcaggatccagacctggtgcagtacgccgactgcaagctcgcggccgccagcggcctgggagaggaggccgaaggttcagagcagagcccgtcgcccacccaactcttcccctggatgcgcccgcaagccgccggacgcaggcgaggccgacagacctacagccgctaccagaccctggagctggagaaggagttcctatttaatccctatctgactcgcaagcgacggatcgaggtatcgcatgcgctgggactgacagagagacaggtcaaaatctggttccagaaccggaggatgaagtggaaaaaagagaacaacaaagacaagttccccagcagcaaatgcgagcaggaggagctggagaaacagaagctggagcgagccccggaggcggcagacgagggcgacgcgcagaagggcgacaagaagtaggctccagctgggactgccagggctgcggccgccctccgtccgcgggtcccccgactgcgccgccgtcgcccgcccccgcccgagagagctctggtcccgggagtcggcccggagcctggcctcccaccgctgcgtccccgccgcgccagtccccgctagtggtagtatctcgtaatagcttctgtgtgtgagctaccgtggatctccttcccttctcttgggggccgggggaaagacaaggattgtaagcaaggactccctcgcttagcgagggtgagcggctgcagcttggctgagccccccaccccccgcccccgcccagtgtaaaaagcctccttgtgcaatggtctcttttcctttgaacgtgcttctttgtaatgaccgaggtaccgatttctgctaagttctcccaacaacatgaaactgcctattcacgccgtaattctttctgtctccctctctctctctctctctctctctctctctc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]