2025-07-03 13:47:48, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_019300941 424 bp mRNA linear PLN 29-NOV-2016 DEFINITION PREDICTED: Ipomoea nil heavy metal-associated isoprenylated plant protein 32-like (LOC109153142), mRNA. ACCESSION XM_019300941 VERSION XM_019300941.1 DBLINK BioProject: PRJNA344313 KEYWORDS RefSeq; includes ab initio. SOURCE Ipomoea nil (Japanese morning glory) ORGANISM Ipomoea nil Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017616696.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Ipomoea nil Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 11% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..424 /organism="Ipomoea nil" /mol_type="mRNA" /cultivar="Tokyo-kokei standard" /db_xref="taxon:35883" /chromosome="Unknown" gene 1..424 /gene="LOC109153142" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 88% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:109153142" CDS 20..424 /gene="LOC109153142" /codon_start=1 /product="heavy metal-associated isoprenylated plant protein 32-like" /protein_id="XP_019156486.1" /db_xref="GeneID:109153142" /translation="
MEPYADASCILRVDINCDACKFKMIEVISSVAGVYSISIDAEENLVKICGEVDPNRLLSALAREGKHAKIVMANLKHPQLRLHPRYGYIQGHDDLGNGGGHGYHPHQAFPIRGALPHHSYYPYHYPSCYIRFGN"
misc_feature 50..226 /gene="LOC109153142" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(62..70,77..79) /gene="LOC109153142" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" ORIGIN
gctgttcactcattcaacaatggagccatacgctgacgccagttgtattctgagagtggatattaattgtgatgcgtgcaaattcaaaatgattgaagttataagttcggtcgcgggtgtgtattcaattagcattgatgcagaggaaaatttggtaaaaatttgtggggaggtggaccctaatcgtctcttgagtgcattagcaagagaaggtaaacatgcaaaaatagtaatggctaacctaaaacaccctcaactaagactacatccaagatatggctatatccaaggtcacgatgaccttggcaatggaggcggccatggctatcaccctcaccaagccttccctataagaggggcactccctcaccattcatactatccataccattatccatcgtgctatataaggtttggaaattag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]