GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-14 01:42:18, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_019300941             424 bp    mRNA    linear   PLN 29-NOV-2016
DEFINITION  PREDICTED: Ipomoea nil heavy metal-associated isoprenylated plant
            protein 32-like (LOC109153142), mRNA.
ACCESSION   XM_019300941
VERSION     XM_019300941.1
DBLINK      BioProject: PRJNA344313
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Ipomoea nil (Japanese morning glory)
  ORGANISM  Ipomoea nil
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae;
            Ipomoeeae; Ipomoea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017616696.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Ipomoea nil Annotation Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..424
                     /organism="Ipomoea nil"
                     /mol_type="mRNA"
                     /cultivar="Tokyo-kokei standard"
                     /db_xref="taxon:35883"
                     /chromosome="Unknown"
     gene            1..424
                     /gene="LOC109153142"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 88% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:109153142"
     CDS             20..424
                     /gene="LOC109153142"
                     /codon_start=1
                     /product="heavy metal-associated isoprenylated plant
                     protein 32-like"
                     /protein_id="XP_019156486.1"
                     /db_xref="GeneID:109153142"
                     /translation="
MEPYADASCILRVDINCDACKFKMIEVISSVAGVYSISIDAEENLVKICGEVDPNRLLSALAREGKHAKIVMANLKHPQLRLHPRYGYIQGHDDLGNGGGHGYHPHQAFPIRGALPHHSYYPYHYPSCYIRFGN"
     misc_feature    50..226
                     /gene="LOC109153142"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(62..70,77..79)
                     /gene="LOC109153142"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
ORIGIN      
gctgttcactcattcaacaatggagccatacgctgacgccagttgtattctgagagtggatattaattgtgatgcgtgcaaattcaaaatgattgaagttataagttcggtcgcgggtgtgtattcaattagcattgatgcagaggaaaatttggtaaaaatttgtggggaggtggaccctaatcgtctcttgagtgcattagcaagagaaggtaaacatgcaaaaatagtaatggctaacctaaaacaccctcaactaagactacatccaagatatggctatatccaaggtcacgatgaccttggcaatggaggcggccatggctatcaccctcaccaagccttccctataagaggggcactccctcaccattcatactatccataccattatccatcgtgctatataaggtttggaaattag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]