GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-16 15:17:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018929682            1026 bp    mRNA    linear   INV 03-NOV-2016
DEFINITION  PREDICTED: Bactrocera latifrons alcohol dehydrogenase
            (LOC108966662), mRNA.
ACCESSION   XM_018929682
VERSION     XM_018929682.1
DBLINK      BioProject: PRJNA351211
KEYWORDS    RefSeq.
SOURCE      Bactrocera latifrons
  ORGANISM  Bactrocera latifrons
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017534408.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Bactrocera latifrons Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1026
                     /organism="Bactrocera latifrons"
                     /mol_type="mRNA"
                     /isolate="USDA-ARS-PBARC rearing strain"
                     /isolation_source="USDA-ARS-PBARC rearing colony"
                     /db_xref="taxon:174628"
                     /chromosome="Unknown"
                     /tissue_type="whole fly"
                     /country="USA: USDA-ARS-PBARC, Hilo, Hawaii"
                     /collection_date="2015"
     gene            1..1026
                     /gene="LOC108966662"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 27 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:108966662"
     CDS             88..864
                     /gene="LOC108966662"
                     /codon_start=1
                     /product="alcohol dehydrogenase"
                     /protein_id="XP_018785227.1"
                     /db_xref="GeneID:108966662"
                     /translation="
MGLTGKNVVFVGGLGYIGYEACKKIMTKNVSSFFVFDVLENAENIKALQAINPKTKVYYTKFDITNKASIKSALADVVAKVQYIDVLVNGAGILADPNVELTMNINLIGLIHTTLEAIPLMDKNKKGRGGLIVNIASVLGLEPAPPTAVYCASKFGVMGFSRSLGDPYYYNLTGIAVVTFCPGLTDTPLKNNIATKYTFEYSKVIGEKLNNTKTQKPEACGAHLAEVVESAENGGIYISNQGTLSKVTPTVYWQPTFN"
     misc_feature    103..831
                     /gene="LOC108966662"
                     /note="insect type alcohol dehydrogenase (ADH)-like,
                     classical (c) SDRs; Region: ADH_SDR_c_like; cd05323"
                     /db_xref="CDD:187584"
     misc_feature    order(121..123,127..138,196..204,271..282,355..366,
                     400..402,490..498,535..537,547..549,631..642,646..657)
                     /gene="LOC108966662"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187584"
     misc_feature    order(382..387,394..396,406..411,418..423,430..432,
                     439..441,499..501,508..516,520..525,529..534,538..546,
                     550..555,562..567,574..579,583..588,637..639,721..723,
                     805..807,826..831)
                     /gene="LOC108966662"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187584"
     misc_feature    order(403..405,496..498,535..537,547..549)
                     /gene="LOC108966662"
                     /note="active site"
                     /db_xref="CDD:187584"
ORIGIN      
aaatggcattagttgcgaagtgtccacagcacagaaacaaacgttaagcgccagtgaagcaaagtgaataagactgatttaagtgaaatgggtttgaccggtaaaaatgtcgttttcgttggcggtttgggctacatcggctacgaggcctgcaaaaagattatgaccaagaatgtgtcgtctttcttcgtgttcgacgttttggaaaatgctgagaacatcaaggcgctgcaggccatcaatcccaagaccaaggtgtactacaccaaattcgacatcaccaataaggcgagcattaagtcggcactcgccgatgttgtcgccaaagtgcaatacattgatgtgctcgtcaatggcgccggcatactcgctgatcccaatgttgagctgaccatgaacatcaacttgattggtctcattcacaccacgctcgaggccattccactcatggacaagaacaagaagggacgcggcggtctgattgttaatattgcttcggtgttgggtttggagcccgcaccacccaccgccgtctactgcgcatcgaaattcggtgttatgggcttctcgcgttcacttggcgatccatactattacaaccttaccggcattgcggtggtcactttctgtcccggtttgactgatacgcccttgaagaacaacattgccaccaaatatacttttgagtactccaaggtgattggtgagaagctgaacaacaccaagacacagaaacccgaagcttgtggcgctcatttggctgaggtggtcgagtcagccgagaatggtggcatctatatmagcaaccaaggtactttgtccaaggtcacaccgaccgtctactggcaacccacattcaactaggctttccagcgcacatctgagatattttgaaatattgtatatacatgtaaatatgtacatacgtatgtgtagatatatatatatatatatatatatgtatgttatttagtttataagttaaaagtctgaattgaataaatcttcattagttttacattaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]