2024-05-05 20:22:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018881381 600 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Oye2p (OYE2), partial mRNA. ACCESSION XM_018881381 VERSION XM_018881381.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 600) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 600) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 600) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031671). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..600 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="C" gene <1..>600 /gene="OYE2" /locus_tag="AWJ20_4314" /db_xref="GeneID:30036433" CDS 1..600 /gene="OYE2" /locus_tag="AWJ20_4314" /inference="similar to AA sequence:KEGG_Orthology:K00354" /note="Conserved NADPH oxidoreductase containing flavin mononucleotide (FMN); responsible for geraniol reduction into citronellol during fermentation; homologous to Oye3p with different ligand binding and catalytic properties; may be involved in sterol metabolism, oxidative stress response, and programmed cell death; protein abundance increases in response to DNA replication stress; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 - mitochondrion [Evidence IDA] [PMID 17897954]; GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID 14562095]; GO_function: GO:0010181 - FMN binding [Evidence IEA]; GO_function: GO:0003959 - NADPH dehydrogenase activity [Evidence IEA]; GO_function: GO:0003959 - NADPH dehydrogenase activity [Evidence IDA,ISS] [PMID 8454584]; GO_function: GO:0003824 - catalytic activity [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase activity [Evidence IEA,IEA]; GO_function: GO:0018548 - pentaerythritol trinitrate reductase activity [Evidence IEA]; GO_function: GO:0052690 - trichloro-p-hydroquinone reductive dehalogenase activity [Evidence IEA]; GO_process: GO:0006915 - apoptotic process [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 - oxidation-reduction process [Evidence IEA,IEA]" /codon_start=1 /product="Oye2p" /protein_id="XP_018733976.1" /db_xref="GeneID:30036433" /translation="
MSRFETYPITYRARRIESRFLVMAGSVSPLFQPIKVGRATLQHRVAMAPLTRRRSPNHVPTDLVAEYYEQRASRPGTLIITEAAFIAKKAGGLSGAPGIWSQEQITAWKKVFDRIRAKQSFAFVQLWALGNRAYIPDLEEDGIKNYYVSASDVKARDDTPNPRPLTKSEIKEYIELYAQAAKNAIAAGASGVELHSANG"
misc_feature 85..>597 /gene="OYE2" /locus_tag="AWJ20_4314" /note="TIM-like beta/alpha barrel domains; Region: TIM; cl21457" /db_xref="CDD:451249" ORIGIN
atgtcgcgattcgagacttatccgattacatatcgtgcaagacgcattgagagcaggtttttggtcatggctgggtcggtgtctcctctgtttcaacctataaaagtcggtagagccactctgcaacacagagtggccatggctccattgacaagacggcggtcgccgaaccacgttcctactgacctcgtagcagagtattacgaacagcgggcgtcgagaccaggtactcttattattacagaggcagcatttattgcaaagaaagcaggtggtctcagtggtgctcctgggatatggtctcaagaacagattactgcatggaagaaagtgtttgatagaattcgtgccaaacagtcgtttgcgtttgtccagctgtgggctcttggtaacagagcatacatccccgatctcgaggaagatgggattaaaaactattacgtttcagcgtcagacgtcaaagcaagagacgacacccctaatccacgaccactcaccaaatccgaaatcaaggagtatatcgagctgtatgctcaggcggccaagaacgccattgcagcaggagcttcaggtgtcgaactccattcagccaacgggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]