LOCUS       XM_018879618            1110 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Oye3p (OYE3), partial mRNA.
ACCESSION   XM_018879618
VERSION     XM_018879618.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 1110)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1110)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1110)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031674).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1110
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="B"
     gene            <1..>1110
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /db_xref="GeneID:30034596"
     CDS             1..1110
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /inference="similar to AA sequence:KEGG_Orthology:K00354"
                     /note="Conserved NADPH oxidoreductase containing flavin
                     mononucleotide (FMN); homologous to Oye2p with different
                     ligand binding and catalytic properties; has potential
                     roles in oxidative stress response and programmed cell
                     death; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0010181 - FMN binding
                     [Evidence IEA]; GO_function: GO:0003959 - NADPH
                     dehydrogenase activity [Evidence IEA]; GO_function:
                     GO:0003959 - NADPH dehydrogenase activity [Evidence
                     IDA,ISS] [PMID 7836424]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0016491
                     - oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0018548 - pentaerythritol trinitrate reductase activity
                     [Evidence IEA]; GO_function: GO:0052690 -
                     trichloro-p-hydroquinone reductive dehalogenase activity
                     [Evidence IEA]; GO_process: GO:0006915 - apoptotic process
                     [Evidence IMP] [PMID 17897954]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Oye3p"
                     /protein_id="XP_018737517.1"
                     /db_xref="GeneID:30034596"
                     /translation="

MTVTSTTPSLFTPLKVGDLQLQHRVAMAPLTRFRTPNHIPPEVFGDYYEQRASRAGTLIVTEATLIAPQAGGYENVPGIWSQEQIKAWKSVMNKINGKKSYAFMQLWALGRVAHQDILDKEGVASDVVSASDVPLGETSDIPRPLTELEIKEYIRLYAQAAKNAIEAGASGVELHGANGYLPDQFLHESTNRRTDEYGGSIENRARFALEVIDALIEAVGAKRVAVRLSPFGEFNNMHPGVSPIPQWSYLISELERRAQQGNRLAYIHLVEPRVNGNVDIEYTGSNEFARNIWQGILVRAGGLIRDAEKFAESDPNTVVALGRYFISNPDLVDRLQKKIPLTPYNRETFYATDPHDTRGYIEFKFASQQ"

     misc_feature    28..1038
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(85..87,91..93,187..189,313..315,679..681,901..903,
                     958..960,964..972)
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(85..87,91..93,187..189,313..315,319..321,340..342,
                     523..525,532..534,538..540,679..681,700..702,901..903,
                     958..960,964..969)
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(91..93,319..321,523..525,532..534,538..540,967..969)
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    538..540
                     /gene="OYE3"
                     /locus_tag="AWJ20_2660"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
ORIGIN      

atgaccgttacatctactactccatctttattcacccctctcaaggttggtgatttgcaacttcaacatcgtgttgctatggcaccattgaccagatttagaactccaaatcacattcctcctgaggtttttggtgattattatgaacagagagcctctagagctggaactttaattgttaccgaagctactcttattgctcctcaagctggaggatatgaaaatgtccccggaatctggtctcaagaacagattaaagcttggaagagtgtaatgaacaagattaacggaaagaaatcttatgctttcatgcagctgtgggctcttggaagagttgctcaccaagatattcttgacaaagaaggtgtcgctagtgatgtagtttctgcttcagatgttcctcttggtgagactagtgatattcctagacctcttacagagctagaaatcaaagagtatattagactgtatgctcaagccgctaagaatgccattgaagcaggagcttctggtgtcgaattacatggagccaacggctatttaccagaccagtttcttcatgaatccactaaccgtcgtaccgatgagtatggcggatcgattgagaacagagccagatttgctctagaggttatcgatgctttaattgaagctgttggtgctaagagagtcgcagtaagattatctcctttcggagagttcaataatatgcaccctggagtttcaccaattccacagtggtcatatttgattagcgagcttgagagaagagctcaacagggaaaccgattggcttatattcatcttgttgagcctcgtgttaacggtaacgtcgatattgaatatacgggtagtaacgagtttgcccgaaatatttggcagggtattcttgtgcgagccggtggcttgatccgggacgctgagaagtttgccgaaagtgacccaaacactgttgtagctcttggtcgatatttcatctcgaacccagatcttgtggatagattacagaagaagattcctctgacaccttataatagagagaccttttatgctactgatcctcatgacactagaggatatattgagttcaagtttgcatcccagcagtag

//