LOCUS       XM_018878568             513 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans squalene monooxygenase (ERG1), partial
            mRNA.
ACCESSION   XM_018878568
VERSION     XM_018878568.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 513)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 513)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 513)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031672).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..513
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="A"
     gene            <1..>513
                     /gene="ERG1"
                     /locus_tag="AWJ20_1671"
                     /db_xref="GeneID:30033499"
     CDS             1..513
                     /gene="ERG1"
                     /locus_tag="AWJ20_1671"
                     /inference="similar to AA sequence:KEGG_Orthology:K00511"
                     /note="Squalene epoxidase; catalyzes the epoxidation of
                     squalene to 2,3-oxidosqualene; plays an essential role in
                     the ergosterol-biosynthesis pathway and is the specific
                     target of the antifungal drug terbinafine; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 9450962]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0043231 -
                     intracellular membrane-bounded organelle [Evidence IEA];
                     GO_component: GO:0005811 - lipid particle [Evidence IDA]
                     [PMID 24868093]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 9450962]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031090 -
                     organelle membrane [Evidence IEA]; GO_function: GO:0008144
                     - drug binding [Evidence IMP] [PMID 14638499];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004506 - squalene monooxygenase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004506 - squalene monooxygenase
                     activity [Evidence IMP] [PMID 200835]; GO_function:
                     GO:0004506 - squalene monooxygenase activity [Evidence
                     IDA] [PMID 9450962]; GO_process: GO:0006696 - ergosterol
                     biosynthetic process [Evidence IMP] [PMID 200835];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="squalene monooxygenase"
                     /protein_id="XP_018735858.1"
                     /db_xref="GeneID:30033499"
                     /translation="

MSDRDYDYVIVGAGIAGPALAVGFAKSGRSVLVVERDLREPDRIVGELLQPGGVNALRELGIEHALEGIDAVPSKGYQVFYHGETVNIPYPTIEADGKTQEVTGRSFHHGRFVMNLRKAASETPGVTFLEANVTEIITNPHTGHVLGVKTVDKTGRLQHVSYFAKPPCSS"

     misc_feature    13..>414
                     /gene="ERG1"
                     /locus_tag="AWJ20_1671"
                     /note="squalene epoxidase; Provisional; Region: PTZ00367"
                     /db_xref="CDD:240384"
ORIGIN      

atgtcggacagagattatgactacgtaattgttggtgctggtatagcaggacctgcactagcggttgggtttgctaaatcaggtagatcagtattggtggtggaacgagacttacgagaaccagatcggattgttggtgaacttctacagccaggtggagtaaacgctcttcgagaattaggcattgaacacgctctcgaaggaatagacgcagtcccttctaaaggttatcaagtgttttaccacggagagactgtaaatatcccatatccgacaatagaagccgatggcaagactcaagaagtcactggaagaagtttccaccatggcagattcgtcatgaacctaaggaaggctgccagtgaaacccctggagttacatttttagaggccaatgtaacagaaataatcaccaatccacacacaggccatgttttaggggtcaagactgtcgacaagactggtcgtttacaacatgtaagttattttgcaaagccaccatgttccagttag

//