GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:32:35, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_018858572             300 bp    mRNA    linear   PLN 28-AUG-2017
DEFINITION  Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal
            protein L36e (METBIDRAFT_76691), partial mRNA.
ACCESSION   XM_018858572
VERSION     XM_018858572.1
DBLINK      BioProject: PRJNA342692
            BioSample: SAMN00773783
KEYWORDS    RefSeq.
SOURCE      Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993
  ORGANISM  Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Metschnikowiaceae;
            Metschnikowia.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Riley,R., Haridas,S., Wolfe,K.H., Lopes,M.R., Hittinger,C.T.,
            Goker,M., Salamov,A.A., Wisecaver,J.H., Long,T.M., Calvey,C.H.,
            Aerts,A.L., Barry,K.W., Choi,C., Clum,A., Coughlan,A.Y.,
            Deshpande,S., Douglass,A.P., Hanson,S.J., Klenk,H.P., LaButti,K.M.,
            Lapidus,A., Lindquist,E.A., Lipzen,A.M., Meier-Kolthoff,J.P.,
            Ohm,R.A., Otillar,R.P., Pangilinan,J.L., Peng,Y., Rokas,A.,
            Rosa,C.A., Scheuner,C., Sibirny,A.A., Slot,J.C., Stielow,J.B.,
            Sun,H., Kurtzman,C.P., Blackwell,M., Grigoriev,I.V. and
            Jeffries,T.W.
  TITLE     Comparative genomics of biotechnologically important yeasts
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 113 (35), 9882-9887 (2016)
   PUBMED   27535936
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Riley,R., Haridas,S., Wolfe,K.H., Lopes,M.R., Hittinger,C.T.,
            Goker,M., Salamov,A., Wisecaver,J., Long,T.M., Aerts,A.L.,
            Barry,K., Choi,C., Clum,A., Coughlan,A.Y., Deshpande,S.,
            Douglass,A.P., Hanson,S.J., Klenk,H.-P., LaButti,K., Lapidus,A.,
            Lindquist,E., Lipzen,A., Meier-kolthoff,J.P., Ohm,R.A.,
            Otillar,R.P., Pangilinan,J., Peng,Y., Rokas,A., Rosa,C.A.,
            Scheuner,C., Sibirny,A.A., Slot,J.C., Stielow,J.B., Sun,H.,
            Kurtzman,C.P., Blackwell,M., Jeffries,T.W., Grigoriev,I.V.,
            Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_017387731).
            
            ##Metadata-START##
            Organism Display Name :: Metschnikowia bicuspidata NRRL YB-4993
            GOLD Stamp ID         :: Gp0018361
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Metschnikowia bicuspidata var. bicuspidata NRRL
                     YB-4993"
                     /mol_type="mRNA"
                     /strain="NRRL YB-4993"
                     /variety="bicuspidata"
                     /db_xref="taxon:869754"
                     /chromosome="Unknown"
     gene            <1..>300
                     /locus_tag="METBIDRAFT_76691"
                     /db_xref="GeneID:30031548"
     CDS             1..300
                     /locus_tag="METBIDRAFT_76691"
                     /codon_start=1
                     /product="ribosomal protein L36e"
                     /protein_id="XP_018714206.1"
                     /db_xref="GeneID:30031548"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="JGIDB:Metbi1_76691"
                     /translation="
MAQTGIAVGLNKGHKTTQKEVVPRLSRKKGVLSKRAAFVRSIVSEVSGLAPYERRLIELIRNASEKRAKKLAKKRLGTHKRALRKVEEMNKIIAESKRH"
ORIGIN      
atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]