2024-05-20 11:05:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018639397 486 bp mRNA linear INV 07-MAY-2019 DEFINITION PREDICTED: Metaseiulus occidentalis polyadenylate-binding protein 1-B-like (LOC108864213), mRNA. ACCESSION XM_018639397 VERSION XM_018639397.1 DBLINK BioProject: PRJNA166945 KEYWORDS RefSeq; includes ab initio. SOURCE Galendromus occidentalis (western predatory mite) ORGANISM Galendromus occidentalis Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida; Acari; Parasitiformes; Mesostigmata; Gamasina; Phytoseioidea; Phytoseiidae; Typhlodrominae; Galendromus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003805424.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Galendromus occidentalis Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..486 /organism="Galendromus occidentalis" /mol_type="mRNA" /db_xref="taxon:34638" /chromosome="Unknown" gene 1..486 /gene="LOC108864213" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108864213" CDS 1..486 /gene="LOC108864213" /codon_start=1 /product="polyadenylate-binding protein 1-B-like" /protein_id="XP_018494913.1" /db_xref="GeneID:108864213" /translation="
MNLGIKRLAQVCFLLLLAASPSFPHKVVKLAAVAALLRGGPVIPVPIRYKVPQQTKIVHYPVRVPVHVPVHHHTQREVRVIHVPVHHYTHREQHHSHRPIHHHHVEVLHPQNYYHPQHYQPSMGQTVHRDDVYGGHDGAQDMGDGVNDGAYAYGGDIQYAY"
ORIGIN
atgaacttaggtatcaagcggctggctcaagtatgtttcttactcctactggcagcgtcaccaagttttccacacaaagtggtgaagctcgcggcggtggcggcccttctgagaggtgggccagtgatcccagtgccgattcggtacaaagttccgcagcagaccaagatcgtgcattatccagttcgagttcctgtccacgtccccgtgcatcaccacactcagcgcgaggtgagggtcatccatgtcccggtgcatcactacactcaccgtgagcagcatcactcgcatcgtcccatccaccatcatcacgtcgaagtcttacatccgcaaaattattatcaccctcaacattatcagccgagcatgggtcaaacagtgcatcgagatgatgtttacgggggtcatgacggtgcacaagatatgggcgacggtgtcaacgatggcgcctacgcttacggcggagacatccagtacgcttattga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]