LOCUS       XM_018535268             207 bp    mRNA    linear   PLN 26-SEP-2016
DEFINITION  Alternaria alternata hypothetical protein partial mRNA.
ACCESSION   XM_018535268
VERSION     XM_018535268.1
DBLINK      BioProject: PRJNA342680
            BioSample: SAMN02745592
KEYWORDS    RefSeq.
SOURCE      Alternaria alternata
  ORGANISM  Alternaria alternata
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
            Pleosporaceae; Alternaria; Alternaria sect. Alternaria; Alternaria
            alternata complex.
REFERENCE   1  (bases 1 to 207)
  AUTHORS   Zeiner,C.A., Purvine,S.O., Zink,E.M., Wu,S., Pasa-Tolic,L.,
            Chaput,D.L., Haridas,S., Grigoriev,I.V., Santelli,C.M. and
            Hansel,C.M.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Comparative analysis of secretome profiles of
            manganese(II)-oxidizing ascomycete fungi
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 207)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-SEP-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 207)
  AUTHORS   Zeiner,C.A., Purvine,S.O., Zink,E.M., Wu,S., Pasa-Tolic,L.,
            Chaput,D.L., Haridas,S., Grigoriev,I.V., Santelli,C.M.,
            Hansel,C.M., Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_017306224).
            
            ##Metadata-START##
            Organism Display Name :: Alternaria alternata
            GOLD Stamp ID         :: Gp0047507
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..207
                     /organism="Alternaria alternata"
                     /mol_type="mRNA"
                     /strain="SRC1lrK2f"
                     /db_xref="taxon:5599"
                     /chromosome="Unknown"
     gene            <1..>207
                     /locus_tag="CC77DRAFT_949570"
                     /db_xref="GeneID:29120862"
     CDS             <1..207
                     /locus_tag="CC77DRAFT_949570"
                     /note="expressed protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018379436.1"
                     /db_xref="GeneID:29120862"
                     /db_xref="JGIDB:Altal1_949570"
                     /translation="

EDINSEMYDLFGADHETSTLEFATSDSDHQFPHELCDEGEKSRETLCLTLNDSFNGSTSGKYFSRLRW"

ORIGIN      

gaagacataaactcagagatgtacgatctgtttggagcagaccacgaaacaagcactcttgaattcgcaactagcgatagtgatcaccagtttccccatgaactgtgtgatgagggagagaaaagccgcgaaacattgtgtttgaccttgaacgattcattcaatggaagcacttcaggtaagtacttcagtagactgcggtggtga

//