GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 09:45:43, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_018367307             303 bp    mRNA    linear   PLN 15-JUL-2025
DEFINITION  Saccharomyces eubayanus 60S ribosomal protein eL36 (RPL36A),
            partial mRNA.
ACCESSION   XM_018367307
VERSION     XM_018367307.1
DBLINK      BioProject: PRJNA342694
            BioSample: SAMN02716114
KEYWORDS    RefSeq.
SOURCE      Saccharomyces eubayanus
  ORGANISM  Saccharomyces eubayanus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Baker,E., Wang,B., Bellora,N., Peris,D., Hulfachor,A.B.,
            Koshalek,J.A., Adams,M., Libkind,D. and Hittinger,C.T.
  TITLE     The Genome Sequence of Saccharomyces eubayanus and the
            Domestication of Lager-Brewing Yeasts
  JOURNAL   Mol. Biol. Evol. 32 (11), 2818-2831 (2015)
   PUBMED   26269586
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUL-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Wang,B., Baker,E., Libkind,D., Goncalves,P., Sampaio,J.P. and
            Hittinger,C.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2015) Laboratory of Genetics, University of
            Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology
            Center, Madison, WI 53706-1580, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_030972).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomyces eubayanus"
                     /mol_type="mRNA"
                     /strain="FM1318"
                     /isolation_source="Nothofagus dombeyi infected by Cyttaria
                     hariotii"
                     /host="Cyttaria hariotii"
                     /db_xref="taxon:1080349"
                     /chromosome="XIII"
                     /geo_loc_name="Argentina: Nahuel Huapi, Patagonia"
                     /lat_lon="41.3569 S 71.5157 W"
                     /altitude="906 m"
                     /collection_date="2006"
                     /collected_by="R. Ulloa, Diego Libkind"
                     /identified_by="R. Ulloa, Diego Libkind"
     gene            <1..>303
                     /gene="RPL36A"
                     /locus_tag="DI49_4277"
                     /note="SEUB0M03270"
                     /db_xref="GeneID:28933414"
     CDS             1..303
                     /gene="RPL36A"
                     /locus_tag="DI49_4277"
                     /note="ancestor homolog: Anc_6.283; saccharomyces
                     cerevisiae ortholog: YMR194W"
                     /codon_start=1
                     /product="60S ribosomal protein eL36"
                     /protein_id="XP_018220241.1"
                     /db_xref="GeneID:28933414"
                     /translation="
MAAKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFIRAKAKVEEMNNIISASRRH"
     misc_feature    10..297
                     /gene="RPL36A"
                     /locus_tag="DI49_4277"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]