GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 18:45:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018205225             732 bp    mRNA    linear   PLN 09-DEC-2021
DEFINITION  Mollisia scopiformis uncharacterized protein (LY89DRAFT_128911),
            mRNA.
ACCESSION   XM_018205225
VERSION     XM_018205225.1
DBLINK      BioProject: PRJNA342682
            BioSample: SAMN04009710
KEYWORDS    RefSeq.
SOURCE      Mollisia scopiformis
  ORGANISM  Mollisia scopiformis
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Leotiomycetes; Helotiales; Mollisiaceae; Mollisia.
REFERENCE   1  (bases 1 to 732)
  AUTHORS   Walker,A.K., Frasz,S.L., Seifert,K.A., Miller,J.D., Mondo,S.J.,
            Labutti,K., Lipzen,A., Dockter,R., Kennedy,M., Grigoriev,I.V. and
            Spatafora,J.W.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Full genome of DAOMC 229536 Phialocephala scopiformis, a fungal
            endophyte of spruce producing the potent anti-insectan compound
            rugulosin
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 732)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-DEC-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 732)
  AUTHORS   Mondo,S.J., Walker,A.K., Frasz,S.L., Seifert,K.A., Miller,J.D.,
            Labutti,K., Lipzen,A., Dockter,R., Kennedy,M., Grigoriev,I.V.,
            Spatafora,J.W., Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2015) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_017263596).
            
            ##Metadata-START##
            Organism Display Name :: Phialocephala scopiformis CBS 120377
            GOLD Stamp ID         :: Gp0046824
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..732
                     /organism="Mollisia scopiformis"
                     /mol_type="mRNA"
                     /strain="CBS 120377"
                     /culture_collection="CBS:120377"
                     /db_xref="taxon:149040"
                     /chromosome="Unknown"
     gene            1..732
                     /locus_tag="LY89DRAFT_128911"
                     /db_xref="GeneID:28814951"
     CDS             80..574
                     /locus_tag="LY89DRAFT_128911"
                     /note="expressed protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_018069430.1"
                     /db_xref="GeneID:28814951"
                     /db_xref="JGIDB:Phisc1_128911"
                     /translation="
MKSFTIILAALAATAIAAPVTPRNLVSVRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQDPASVLGRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQNPADVLGRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQNPADVLGK"
ORIGIN      
ttgcttttcacgcaccaacgatccaaacatcattgacaacaccaaacctcacaaattcagacaaaactcgcaaatcacaatgaagagcttcactatcattctcgccgcacttgcagcaacggcaatagctgccccagtcactccccggaacctcgtatccgttcgacgatcagtcagcgatgaggatgttgctgccagcgtcaactacattctagtcctcgagaaagagacttctagcaagatggacgcctaccaggatgaggtggatgccgtccaggatccggccagcgttcttggtcgccgttccgtcagcgacgaagatgttgctgccagcgttaactatattttggttcttgagaaggagacttccagcaagatggacgcctaccaggatgaagttgacgctgtccaaaacccagctgatgtcctgggtcgtcgctctgtcagcgatgaggatgtcgctgctagcgtcaactacatcttggtgctcgagaaagagacgtccagcaagatggatgcctaccaagatgaggttgatgccgttcagaaccctgccgatgttcttggaaagtaggtacattgccgcagagctacgaatatactttcacttagtaagatcccctcaccgctggtgggcaccaggttgctaaccaagactaggggctctaccaatgttccacactcctttggcgatttccttggccttagatttgtgagcaggaaagaagatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]