2024-04-25 18:45:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018205225 732 bp mRNA linear PLN 09-DEC-2021 DEFINITION Mollisia scopiformis uncharacterized protein (LY89DRAFT_128911), mRNA. ACCESSION XM_018205225 VERSION XM_018205225.1 DBLINK BioProject: PRJNA342682 BioSample: SAMN04009710 KEYWORDS RefSeq. SOURCE Mollisia scopiformis ORGANISM Mollisia scopiformis Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Leotiomycetes; Helotiales; Mollisiaceae; Mollisia. REFERENCE 1 (bases 1 to 732) AUTHORS Walker,A.K., Frasz,S.L., Seifert,K.A., Miller,J.D., Mondo,S.J., Labutti,K., Lipzen,A., Dockter,R., Kennedy,M., Grigoriev,I.V. and Spatafora,J.W. CONSRTM DOE Joint Genome Institute TITLE Full genome of DAOMC 229536 Phialocephala scopiformis, a fungal endophyte of spruce producing the potent anti-insectan compound rugulosin JOURNAL Unpublished REFERENCE 2 (bases 1 to 732) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (09-DEC-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 732) AUTHORS Mondo,S.J., Walker,A.K., Frasz,S.L., Seifert,K.A., Miller,J.D., Labutti,K., Lipzen,A., Dockter,R., Kennedy,M., Grigoriev,I.V., Spatafora,J.W., Nordberg,H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (05-OCT-2015) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_017263596). ##Metadata-START## Organism Display Name :: Phialocephala scopiformis CBS 120377 GOLD Stamp ID :: Gp0046824 ##Metadata-END## FEATURES Location/Qualifiers source 1..732 /organism="Mollisia scopiformis" /mol_type="mRNA" /strain="CBS 120377" /culture_collection="CBS:120377" /db_xref="taxon:149040" /chromosome="Unknown" gene 1..732 /locus_tag="LY89DRAFT_128911" /db_xref="GeneID:28814951" CDS 80..574 /locus_tag="LY89DRAFT_128911" /note="expressed protein" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_018069430.1" /db_xref="GeneID:28814951" /db_xref="JGIDB:Phisc1_128911" /translation="
MKSFTIILAALAATAIAAPVTPRNLVSVRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQDPASVLGRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQNPADVLGRRSVSDEDVAASVNYILVLEKETSSKMDAYQDEVDAVQNPADVLGK"
ORIGIN
ttgcttttcacgcaccaacgatccaaacatcattgacaacaccaaacctcacaaattcagacaaaactcgcaaatcacaatgaagagcttcactatcattctcgccgcacttgcagcaacggcaatagctgccccagtcactccccggaacctcgtatccgttcgacgatcagtcagcgatgaggatgttgctgccagcgtcaactacattctagtcctcgagaaagagacttctagcaagatggacgcctaccaggatgaggtggatgccgtccaggatccggccagcgttcttggtcgccgttccgtcagcgacgaagatgttgctgccagcgttaactatattttggttcttgagaaggagacttccagcaagatggacgcctaccaggatgaagttgacgctgtccaaaacccagctgatgtcctgggtcgtcgctctgtcagcgatgaggatgtcgctgctagcgtcaactacatcttggtgctcgagaaagagacgtccagcaagatggatgcctaccaagatgaggttgatgccgttcagaaccctgccgatgttcttggaaagtaggtacattgccgcagagctacgaatatactttcacttagtaagatcccctcaccgctggtgggcaccaggttgctaaccaagactaggggctctaccaatgttccacactcctttggcgatttccttggccttagatttgtgagcaggaaagaagatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]