GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 10:10:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018168289             384 bp    mRNA    linear   INV 29-APR-2022
DEFINITION  PREDICTED: Hyalella azteca cornifin-B-like (LOC108679632), mRNA.
ACCESSION   XM_018168289
VERSION     XM_018168289.1
DBLINK      BioProject: PRJNA342675
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Hyalella azteca
  ORGANISM  Hyalella azteca
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Peracarida;
            Amphipoda; Senticaudata; Talitrida; Talitroidea; Hyalellidae;
            Hyalella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025933300) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Hyalella azteca Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..384
                     /organism="Hyalella azteca"
                     /mol_type="mRNA"
                     /isolate="HAZT.00-mixed"
                     /db_xref="taxon:294128"
                     /chromosome="Unknown"
                     /tissue_type="whole organism"
     gene            1..384
                     /gene="LOC108679632"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108679632"
     CDS             1..384
                     /gene="LOC108679632"
                     /codon_start=1
                     /product="cornifin-B-like"
                     /protein_id="XP_018023778.1"
                     /db_xref="GeneID:108679632"
                     /translation="
MAAFRVNAPGYPPAIETDYPPAIETDYPPATEPAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETDYSPATETDYPTATETDYPPATGTGQISIAVYTLQRTC"
     misc_feature    49..>309
                     /gene="LOC108679632"
                     /note="multifunctional oxoglutarate
                     decarboxylase/oxoglutarate dehydrogenase thiamine
                     pyrophosphate-binding subunit/dihydrolipoyllysine-residue
                     succinyltransferase subunit; Region: kgd; PRK12270"
                     /db_xref="CDD:237030"
ORIGIN      
atggcagcattccgcgtcaatgctcccggttatcctcctgccattgaaactgattatcctcctgccattgaaactgattatcctccggccactgagcctgctcatcctcctgccactgaaactgctcatcctcctgccactgaaactgctcatcctcctgccactgaaactgctcatcctcctgccactgagactgctcaccctcctgctactgagactgctcatcctcctgccactgagactgctcatcctcctgccactgaaactgattattctcctgccaccgaaactgattatcctactgccactgaaactgattatcctcctgccactggaactggtcagatttctattgctgtatacacgctacaacgaacttgctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]