2024-05-02 06:44:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018159941 813 bp mRNA linear INV 29-APR-2022 DEFINITION PREDICTED: Hyalella azteca germ cell nuclear acidic protein-like (LOC108672299), mRNA. ACCESSION XM_018159941 VERSION XM_018159941.1 DBLINK BioProject: PRJNA342675 KEYWORDS RefSeq; includes ab initio. SOURCE Hyalella azteca ORGANISM Hyalella azteca Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Peracarida; Amphipoda; Senticaudata; Talitrida; Talitroidea; Hyalellidae; Hyalella. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025941449) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Hyalella azteca Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..813 /organism="Hyalella azteca" /mol_type="mRNA" /isolate="HAZT.00-mixed" /db_xref="taxon:294128" /chromosome="Unknown" /tissue_type="whole organism" gene 1..813 /gene="LOC108672299" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108672299" CDS 1..813 /gene="LOC108672299" /codon_start=1 /product="germ cell nuclear acidic protein-like" /protein_id="XP_018015430.1" /db_xref="GeneID:108672299" /translation="
MFTTALAATVNGHQSVLLDSRDDATDVAVLAGTDGNSADLIISSGTLELSRGDGLKIIDRPSVQQRRKKPYAERDNCACCVSQHAWLAVPVADTDADDDEVDDDEVDDDEVDDDEADDDEADADEADDDEVDDDEVDDDEADDDEADSDEADDDEADDDEADADEADDDEADDDEVDDDEADDDKADDDEADADETDADEADDDEADDDEADDDEADDDEADDDEADDDEADDGQRITVKNSRHALHSRLARVWGHAEHDNLTVPEQSAH"
ORIGIN
atgtttacaacagcacttgcggcgaccgttaacggacatcagagcgtgctgcttgactcgcgagacgacgccacagacgtggccgtactagcagggactgatggaaactcagcagacctcataataagcagcgggacgctggagctaagccggggtgacgggctcaagattatcgaccgaccgtcggtccagcagcgcaggaagaagccctacgcggagcgcgacaactgcgcgtgttgtgtttcccaacacgcatggcttgcggtgccggtggcggatacggacgctgacgatgatgaggttgacgatgatgaggttgacgatgatgaggttgacgatgatgaggctgacgatgatgaggctgacgctgatgaggctgacgatgatgaggttgacgatgatgaggttgacgatgatgaggctgacgatgatgaagctgactctgatgaggctgacgatgatgaggctgacgatgatgaggctgacgctgatgaggctgacgatgatgaggctgacgatgatgaggttgacgatgatgaggctgacgatgataaggctgacgatgatgaggctgacgctgatgagactgacgctgatgaggctgacgatgatgaggctgacgatgacgaggctgacgatgatgaggctgacgatgatgaggctgacgatgatgaggctgacgatgatgaggctgacgatgggcaacgaatcactgttaaaaattccagacacgcacttcactcgaggctggcgagggtctggggacacgctgagcacgacaacctcaccgtaccagagcagagcgcgcactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]