2024-05-20 09:04:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018036375 357 bp mRNA linear INV 17-OCT-2018 DEFINITION PREDICTED: Ceratina calcarata fibrillin-1-like (LOC108632070), mRNA. ACCESSION XM_018036375 VERSION XM_018036375.2 DBLINK BioProject: PRJNA340002 KEYWORDS RefSeq; includes ab initio. SOURCE Ceratina calcarata ORGANISM Ceratina calcarata Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Anthophila; Apidae; Ceratina; Zadontomerus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017131016.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 17, 2018 this sequence version replaced XM_018036375.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ceratina calcarata Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 6% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..357 /organism="Ceratina calcarata" /mol_type="mRNA" /isolate="Rehan_Ccalc_2016" /host="Rhus typhina" /db_xref="taxon:156304" /chromosome="Unknown" /sex="pooled male and female" /tissue_type="whole body" /country="USA: Durham, NH" /collection_date="2014" /collected_by="Sandra Rehan" /identified_by="Sandra Rehan" gene 1..357 /gene="LOC108632070" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 95% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:108632070" CDS 109..357 /gene="LOC108632070" /codon_start=1 /product="fibrillin-1-like" /protein_id="XP_017891864.2" /db_xref="GeneID:108632070" /translation="
MGAAWGPHCEICPSKDSDNYNELCLDKGFSVDGQDIDECRTIPDLCKNGLCINTLGSYRCVCNKGYKADKTGTQCVGMHSTL"
misc_feature <109..180 /gene="LOC108632070" /note="TB domain; Region: TB; pfam00683" /db_xref="CDD:425818" misc_feature 211..303 /gene="LOC108632070" /note="Calcium-binding EGF domain; Region: EGF_CA; pfam07645" /db_xref="CDD:429571" misc_feature order(211..213,220..222,265..267) /gene="LOC108632070" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" ORIGIN
tttgcagatcgcagagtcggttattgcttcttgcaaacgatcggtggccgatgcactgcgagaacttccgatctaaagacagttactaaagcggattgctgttgcacaatgggcgcagcctggggaccacactgcgagatttgcccttcgaaagactcggacaattacaatgaactttgcttagacaaaggtttctccgtggatggacaagacatcgacgagtgcagaacaattcccgacttgtgtaaaaatgggttgtgcatcaataccctcggttcttatcgatgcgtctgtaacaagggctacaaggctgataaaactgggacccaatgcgtcggtatgcattcgactttataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]