LOCUS       XM_017933426             252 bp    mRNA    linear   INV 26-AUG-2016
DEFINITION  PREDICTED: Habropoda laboriosa broad-complex core protein isoforms
            1/2/3/4/5-like (LOC108571402), mRNA.
ACCESSION   XM_017933426
VERSION     XM_017933426.1
DBLINK      BioProject: PRJNA339959
KEYWORDS    RefSeq.
SOURCE      Habropoda laboriosa
  ORGANISM  Habropoda laboriosa
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Apoidea; Anthophila; Apidae; Habropoda.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017100229.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Habropoda laboriosa Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..252
                     /organism="Habropoda laboriosa"
                     /mol_type="mRNA"
                     /isolate="0110345459"
                     /db_xref="taxon:597456"
                     /chromosome="Unknown"
                     /collection_date="2011-04-02"
     gene            1..252
                     /gene="LOC108571402"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 75% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:108571402"
     CDS             1..252
                     /gene="LOC108571402"
                     /codon_start=1
                     /product="broad-complex core protein isoforms
                     1/2/3/4/5-like"
                     /protein_id="XP_017788915.1"
                     /db_xref="GeneID:108571402"
                     /translation="

MTGLTLNSLNTQSAKKLFTCQLCGKVLCSKASLKRHVADKHAERQEEYRCVICERVYCSRNSLMTHIYTYHKSRPGDIDIKFF"

     misc_feature    58..120
                     /gene="LOC108571402"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(58..60,67..69,106..108,118..120)
                     /gene="LOC108571402"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    148..210
                     /gene="LOC108571402"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      

atgacggggctgaccttgaactctctgaacacccagtcagcgaagaagctgttcacctgccagctgtgcggcaaggtgctatgcagcaaagcatccctgaaacgccacgttgccgacaagcacgccgagcgacaggaggagtacagatgcgtcatctgcgagcgggtttactgctcgcgtaactccctgatgacccacatatatacctatcataagagcagacccggcgacattgacattaagttcttttga

//