GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:50:16, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_017634913             468 bp    mRNA    linear   INV 28-JUL-2016
DEFINITION  PREDICTED: Rhagoletis zephyria alpha-defensin-related sequence
            10-like (LOC108378609), mRNA.
ACCESSION   XM_017634913
VERSION     XM_017634913.1
DBLINK      BioProject: PRJNA331175
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Rhagoletis zephyria (snowberry fruit fly)
  ORGANISM  Rhagoletis zephyria
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Tephritoidea; Tephritidae; Rhagoletis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_016171596.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Rhagoletis zephyria Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..468
                     /organism="Rhagoletis zephyria"
                     /mol_type="mRNA"
                     /isolate="East Lansing"
                     /isolation_source="snowberry"
                     /db_xref="taxon:28612"
                     /chromosome="Unknown"
                     /tissue_type="whole body"
                     /country="USA: Michigan, East Lansing"
                     /collection_date="2010"
     gene            1..468
                     /gene="LOC108378609"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108378609"
     CDS             1..468
                     /gene="LOC108378609"
                     /codon_start=1
                     /product="alpha-defensin-related sequence 10-like"
                     /protein_id="XP_017490402.1"
                     /db_xref="GeneID:108378609"
                     /translation="
MNFHFSLLFPFVLLLLLINLSSIPSNAAIVAESPNEQQKNSSSTDVSLGASEPGNKTLGCCCGPCPCNPCPCNPCPCNPCPCNPCPCNPCPCNPCPCCPCCPCCPCCCQKPVGPSSCVGPTKQTQFESNCNLKPAPLPGDPSNPGGSRPQVSGST"
ORIGIN      
atgaactttcactttagcctactttttccttttgttttgctgctgctgctgatcaacttatcttcgattcccagtaatgctgccattgttgccgaatcgccgaatgaacagcagaagaactcttcatcaactgatgtgagccttggagcctcagagccgggcaataaaaccttgggctgttgttgtggtccttgcccgtgcaatccctgcccatgtaacccatgtccctgcaatccctgtccctgcaatccttgtccgtgtaatccttgtccatgtaatccctgtccctgttgtccctgctgtccctgttgtccgtgttgttgtcagaaaccggttggacctagctcctgcgtgggcccaactaagcagacccaatttgagagcaattgcaacctgaagcccgctcctctgcccggtgaccccagcaatcccggtgggtcacggccgcaggtgagtggcagtacctag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]