2024-04-25 09:06:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_017607840 696 bp mRNA linear INV 28-JUL-2016 DEFINITION PREDICTED: Rhagoletis zephyria dehydrogenase/reductase SDR family member 4-like (LOC108356739), partial mRNA. ACCESSION XM_017607840 VERSION XM_017607840.1 DBLINK BioProject: PRJNA331175 KEYWORDS RefSeq; includes ab initio. SOURCE Rhagoletis zephyria (snowberry fruit fly) ORGANISM Rhagoletis zephyria Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea; Tephritidae; Rhagoletis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_016221299.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Rhagoletis zephyria Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..696 /organism="Rhagoletis zephyria" /mol_type="mRNA" /isolate="East Lansing" /isolation_source="snowberry" /db_xref="taxon:28612" /chromosome="Unknown" /tissue_type="whole body" /country="USA: Michigan, East Lansing" /collection_date="2010" gene <1..696 /gene="LOC108356739" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:108356739" CDS <1..696 /gene="LOC108356739" /codon_start=1 /product="dehydrogenase/reductase SDR family member 4-like" /protein_id="XP_017463329.1" /db_xref="GeneID:108356739" /translation="
TLKHFGGIDIFVSNAAVNPAKSHILETSDEVFEKILAVNLIAPFSLSKDIVPHMVKRGGGNIIYIGSASGYMYQGAQNLSERMAAYAISKTALLGLTKAVAGKCAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQXATSSTSAAPPGAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQTIKRIGRAEEVAGMVAFLCSKDASYISGETCTVAGGNGTRL"
misc_feature <1..693 /gene="LOC108356739" /note="Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl21454" /db_xref="CDD:451247" misc_feature order(115..117,199..201,256..258,268..270) /gene="LOC108356739" /note="active site" /db_xref="CDD:187535" ORIGIN
actctaaaacactttggtggcatcgacatctttgtctcgaatgcggcggtcaacccggcaaagagccacatcctcgaaacgtcggacgaggtctttgaaaagattctggccgtgaacctcatcgcgcccttctccctctccaaggacattgtgccgcacatggtgaaacggggcggcggcaacatcatctacatcggcagcgcctccgggtacatgtaccagggggcgcaaaacctctcggagcggatggccgcctacgccatctcgaagaccgccctgctcggcctcaccaaggcagtggctggaaagtgcgccccgctcaacattcgcgtcaactgcgtcgctccgggcctgattgagacggactttgccgtcagcatcaccggcagccccgactacccgggcagctttctcccgctgcagncggcaacatcatctacatcggcagcgcctccgggcgccccgctcaacattcgcgtcaactgcgtcgctccgggcctgattgagacggactttgccgtcagcatcaccggcagccccgactacccgggcagctttctcccgctgcagaccatcaagagaatcggccgcgccgaggaagtggccggcatggtcgccttcctctgcagcaaagacgccagctacatcagcggcgagacgtgcacggtggccggcggcaatggtacgcgactttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]