2024-04-29 16:11:47, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_017102272 411 bp mRNA linear INV 07-OCT-2022 DEFINITION PREDICTED: Drosophila biarmipes uncharacterized LOC108029766 (LOC108029766), mRNA. ACCESSION XM_017102272 VERSION XM_017102272.3 DBLINK BioProject: PRJNA325502 KEYWORDS RefSeq. SOURCE Drosophila biarmipes ORGANISM Drosophila biarmipes Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_066615) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 3, 2022 this sequence version replaced XM_017102272.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: Drosophila biarmipes Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..411 /organism="Drosophila biarmipes" /mol_type="mRNA" /strain="raj3" /db_xref="taxon:125945" /chromosome="2R" /sex="female" /tissue_type="whole-body" /dev_stage="adult" gene 1..411 /gene="LOC108029766" /note="uncharacterized LOC108029766; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108029766" CDS 94..411 /gene="LOC108029766" /codon_start=1 /product="uncharacterized protein LOC108029766" /protein_id="XP_016957761.1" /db_xref="GeneID:108029766" /translation="
MASATSSSARHLFDESKKRLCARVGVNVNNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSEYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVTAMER"
misc_feature 94..402 /gene="LOC108029766" /note="BLOC-1-related complex sub-unit 7; Region: BORCS7; pfam16088" /db_xref="CDD:406483" ORIGIN
gccattaaatattttatctcagctgtttctccctgactttgtttacaattagcgagtttattaacatttaaacagcgttaaaccataaataaaatggcctctgcgaccagttcaagtgctcgacatttattcgacgagtccaagaagagattgtgtgcccgcgtgggtgtaaacgtgaataatttgggatctgtggcccgacaggttgtcaggggctccaagagcaacgagatcatgcatcaaaccctgaagaacttcacccaagtggacgtggtctcggaatacagccaccagaatctgcagaagatgacgctgatcctgcagcacgtgggctaccagtacgatgtgatgcaggatagtgtcaaccacttggattacctcaaggagcaggtgacggccatggaaagatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]