LOCUS       XM_017086478             522 bp    mRNA    linear   INV 27-OCT-2020
DEFINITION  PREDICTED: Drosophila suzukii protein new-glue 1 (LOC108018888),
            mRNA.
ACCESSION   XM_017086478
VERSION     XM_017086478.2
DBLINK      BioProject: PRJNA670404
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila suzukii
  ORGANISM  Drosophila suzukii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_023496841.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 27, 2020 this sequence version replaced XM_017086478.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila suzukii Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 47% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..522
                     /organism="Drosophila suzukii"
                     /mol_type="mRNA"
                     /strain="WT3_2.0"
                     /db_xref="taxon:28584"
                     /chromosome="X"
                     /map="unlocalized"
                     /country="USA: Watsonville, CA"
                     /collection_date="2009-09"
     gene            1..522
                     /gene="LOC108018888"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108018888"
     CDS             1..522
                     /gene="LOC108018888"
                     /codon_start=1
                     /product="protein new-glue 1"
                     /protein_id="XP_016941967.2"
                     /db_xref="GeneID:108018888"
                     /translation="

MKITLVLLAICLGCVMIHQSEAQTATTTTTAATTTTSAAATTTTSAAAAAATTTTTAATTTTTAASTTTTTSASASSTTTTTASPSSTEKKKKVVQRSETIVEPGRQIRISSSKGGQGCGCGCDCECCKSGKSGNCCKSGKSGNCCKSGKSGKSGKSCNKSNQSSGIKEWFKF"

ORIGIN      

atgaagatcaccttggtactcctcgccatctgcctcggctgtgtgatgatccaccagtcggaggctcagaccgccaccaccaccaccaccgccgccaccaccaccacttccgccgccgccactaccaccacttccgccgccgccgccgccgccaccaccaccaccactgccgctacgaccaccactaccgccgcctccaccaccactaccacttccgcttccgcctcctccaccaccactaccactgcatcgccatcttctacagaaaaaaagaagaaagtagtccagcgcagcgaaacgatagtggaacccggaaggcagattagaatttctagcagtaagggaggacagggttgcggttgcggttgcgattgcgaatgttgcaagagtggaaagagtggcaactgttgcaagagtggaaagagtggcaactgttgcaagagtggcaagagcggcaagagcggcaagagttgcaacaagagcaaccagagcagcggcataaaggagtggttcaagttctga

//