LOCUS       XM_016815976            1188 bp    mRNA    linear   PLN 06-AUG-2024
DEFINITION  PREDICTED: Gossypium hirsutum calcium load-activated calcium
            channel (LOC107891247), mRNA.
ACCESSION   XM_016815976
VERSION     XM_016815976.2
DBLINK      BioProject: PRJNA713846
KEYWORDS    RefSeq.
SOURCE      Gossypium hirsutum (cotton)
  ORGANISM  Gossypium hirsutum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
            Gossypium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_053445.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 25, 2021 this sequence version replaced XM_016815976.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_007990345.1-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1188
                     /organism="Gossypium hirsutum"
                     /mol_type="mRNA"
                     /isolate="1008001.06"
                     /db_xref="taxon:3635"
                     /chromosome="D09"
     gene            1..1188
                     /gene="LOC107891247"
                     /note="calcium load-activated calcium channel; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2285 long SRA reads, 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:107891247"
     CDS             378..962
                     /gene="LOC107891247"
                     /codon_start=1
                     /product="calcium load-activated calcium channel"
                     /protein_id="XP_016671465.1"
                     /db_xref="GeneID:107891247"
                     /translation="

MATPQFLSSFQYSDSLTVVAISFCTAIVCEAISWLLIYRTNSYKSLKSSIDKAAKKLETMKTDQNPSKLSTKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLIVVFGFLNSLFEGKVVAKLPFKPIGIVMKMSHRGLKGDDSTDCSMVFLYFLCSISIRTNLQKFLGFSPPRGAAGAGLFPMPDPKTN"

     misc_feature    420..899
                     /gene="LOC107891247"
                     /note="Integral membrane protein EMC3/TMCO1-like; Region:
                     EMC3_TMCO1; pfam01956"
                     /db_xref="CDD:396507"
ORIGIN      

gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccattgtctgcgaagccatctcatggctcttaatctaccgcaccaactcttacaaatccctcaaatcctctatcgacaaagccgccaagaaactcgaaaccatgaaaaccgaccaaaaccctagcaagttgtccaccaaaaaatccaaaaccaagaagatcgaccgtgtcgaaaccagcctcaaagaatccagccgtgacctttccttattcaagttcaaatctggggctgtcgtcgccctcgttttgatcgtcgtttttggcttcttgaattctcttttcgaaggcaaagttgtcgccaaattgccctttaagcccatcgggatcgtgatgaagatgagtcatagaggattaaaaggggacgattccaccgattgctccatggtctttctctacttcttgtgttccatcagtataaggactaatttgcagaagtttttggggttttcgccgccgcgaggtgctgctggcgctgggttgttcccaatgcctgatcccaagactaattgagtctttttttcaggttccttttttataatttagctaccgtttgagaatcaagaatttaggtaatggatatttggagttttgggcttttatgtgataattggtgacgacaactggttttatattttaaatcattgttttctaattttgattattgttaacttttataagttccgatgtttgaattttagattggaataatcattgcttgattgtcatctttctctaa

//