GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 04:57:31, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_016815976            1188 bp    mRNA    linear   PLN 25-APR-2021
DEFINITION  PREDICTED: Gossypium hirsutum calcium load-activated calcium
            channel (LOC107891247), mRNA.
ACCESSION   XM_016815976
VERSION     XM_016815976.2
DBLINK      BioProject: PRJNA713846
KEYWORDS    RefSeq.
SOURCE      Gossypium hirsutum (cotton)
  ORGANISM  Gossypium hirsutum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
            Gossypium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_053445.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 25, 2021 this sequence version replaced XM_016815976.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gossypium hirsutum Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1188
                     /organism="Gossypium hirsutum"
                     /mol_type="mRNA"
                     /isolate="1008001.06"
                     /db_xref="taxon:3635"
                     /chromosome="D09"
     gene            1..1188
                     /gene="LOC107891247"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2285 long SRA reads, 7 Proteins,
                     and 100% coverage of the annotated genomic feature by
                     RNAseq alignments"
                     /db_xref="GeneID:107891247"
     CDS             378..962
                     /gene="LOC107891247"
                     /codon_start=1
                     /product="calcium load-activated calcium channel"
                     /protein_id="XP_016671465.1"
                     /db_xref="GeneID:107891247"
                     /translation="
MATPQFLSSFQYSDSLTVVAISFCTAIVCEAISWLLIYRTNSYKSLKSSIDKAAKKLETMKTDQNPSKLSTKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLIVVFGFLNSLFEGKVVAKLPFKPIGIVMKMSHRGLKGDDSTDCSMVFLYFLCSISIRTNLQKFLGFSPPRGAAGAGLFPMPDPKTN"
     misc_feature    420..899
                     /gene="LOC107891247"
                     /note="Integral membrane protein DUF106; Region: DUF106;
                     pfam01956"
                     /db_xref="CDD:396507"
ORIGIN      
gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccattgtctgcgaagccatctcatggctcttaatctaccgcaccaactcttacaaatccctcaaatcctctatcgacaaagccgccaagaaactcgaaaccatgaaaaccgaccaaaaccctagcaagttgtccaccaaaaaatccaaaaccaagaagatcgaccgtgtcgaaaccagcctcaaagaatccagccgtgacctttccttattcaagttcaaatctggggctgtcgtcgccctcgttttgatcgtcgtttttggcttcttgaattctcttttcgaaggcaaagttgtcgccaaattgccctttaagcccatcgggatcgtgatgaagatgagtcatagaggattaaaaggggacgattccaccgattgctccatggtctttctctacttcttgtgttccatcagtataaggactaatttgcagaagtttttggggttttcgccgccgcgaggtgctgctggcgctgggttgttcccaatgcctgatcccaagactaattgagtctttttttcaggttccttttttataatttagctaccgtttgagaatcaagaatttaggtaatggatatttggagttttgggcttttatgtgataattggtgacgacaactggttttatattttaaatcattgttttctaattttgattattgttaacttttataagttccgatgtttgaattttagattggaataatcattgcttgattgtcatctttctctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]